Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: December 5471
Next month in: 03:29:03
Server time: 12:30:56, April 19, 2024 CET
Currently online (1): burgerboys | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Selucian Liberal People's Party[?]

This page contains information about the Selucian Liberal People's Party.

This party is inactive.

Details

User[?]: swannmotion

Nation[?]: Principatus Selucianus (Selucia)

Seats[?] in Senātus Populī[?]: 0

Color[?]:

 

Description[?]:

Selucia People\\\\\\\'s Party is a party only making decisions in the best interest of the selucians. that means, to take care of the people in this country, who has worked long and hard. But at the same time to help people who dosen\\\\\\\'t work, to get a job. the people who dosen\\\\\\\'t work are not in the interest of Selucia, that also means a very strict integrationpolicy.
Abortion: We are supportive the free abortion, so the young women, aren\\\\\\\'t forced to give birth in an young age.
Euthanasia: We are also supportive to euthanasia, aslong as it is the patients own wish.
Death Penalty: We are heavily against death penalty, because death isn\\\\\\\'t a true punishment. Prison and rehabilitation is the way forward.

We have a very national socialistic platform, we want the best for the Selucian citizens, so therefore, we all have to help so we can build a strong united country.
A socieity must be judged after how it treats its worst-off citizens, care of the elders, the sick and the disabled is a public task, which should never be perceived as a burden, but a dear task we must carry with joy.
the waiting list to the hospitals must be completely removed, and the hospitals must have an effective and friendly treatment.
The requirements for how we treat the environment, must be tougher and be followed by all. Consumers should be sure that the food sold are of the highest quality and without harmful substances.
Selucia is a good country. But unfortunately there are places where you do not feel comfortable being. Many - particularly the elderly and women - are afraid to move freely. We cannot watch that. We will instead ensure that it will be the perpetrators of violence, which will be insecure.
We appreciate the constitution og Selucia as the foundation of democracy, there should be further developed through a more direct democracy.

Dux Ducis Coadunatio:

Sir John Hughes Jr. (Establiser) (2642)

Chairman of Party:

Marc Gouiffe Al Gouffan (2642-2649) - Left because of familiy.
Clement Reed Beresford (2649-2652) - Was fired because of lack to maintain a good relationship to the other parties.
Lars Andreassen (2652-2657) - Got SLPP into the cabinet, with their best voting result ever, that also made them the second biggest party. (123 seats). Resigned, when asked to be head of government
Mick Dahlenbeck (2657-present) - Appoined on his 28 year old birthday.

SLPP ministers

May 2652 - ?
Ministry of Internal Affairs. Richard Hastings
Ministry of Justice Sandor Orghelle
Ministry of Food and Agriculture Henning Karlsen

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketregulator-leaningmoderateperfect
Militarymoderate militaristlimitedperfect
Moralitymoderate conservativelimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 26443,871,578158,600,6542.44+2.44115002.20+11
May 264822,590,752148,120,83815.25+12.817750015.40+66
May 265237,638,004155,608,41724.19+8.9412350024.60+46
May 265648,859,911153,196,29531.89+7.7116050032.00+37
August 265840,631,152124,954,54532.52+0.6216550033.00+5
August 266233,253,383165,950,79020.04-12.4810150020.20-64
August 266631,879,244166,030,99819.20-0.849750019.40-4

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Selucian Liberal People's Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471

BillCreatedVoting startedVoteBill StatusResult
Ending National Media SubsidizationDecember 2678April 2679defeated
Continued Religious FreedomDecember 2678January 2679defeated
Free Market EnergyDecember 2678January 2679passed
Pharmaceuticals PrivatizationDecember 2678January 2679passed
Abortion Reform 2.0December 2678January 2679defeated
Cabinet Proposal of December 2678December 2678December 2678passed
An Act re-structuring foreign Admissions (RSA)November 2678May 2679defeated
An Act improving the Quality of televising (RSA)November 2678April 2679defeated
An Act on the Sale of Arms (RSA)November 2678February 2679defeated
An Act affirming marriage Policy (RSA)November 2678February 2679passed
'Let's not torture animals to develop better make-up' Act (RSA)July 2678January 2679defeated
Authority of the Imperator (Constitutional Amendment) (RSA)July 2678July 2678passed
An Act reforming governmental Involvement in Schooling (RSA)May 2678November 2678passed
Freedom to Hire PolicyMarch 2678March 2679defeated
Extradition Act (Citizens' Protections) (RSA)February 2678January 2679passed
An Amendment to further the Rights of the Citizenry (RSA)November 2677July 2678passed
An Act to save public Moneys (RSA)November 2677May 2678defeated
An Act on Prayer in Schools (RSA)November 2677May 2678passed
Army Rationalisation Act (Military Control of Operations) (RSA)November 2677May 2678defeated
Compensation Act on Compulsory Acquisitions (Eminent Domain) (RSA)November 2677May 2678passed

Random fact: Players who deliberately attempt to present a misleading picture of the nation's current RP laws will be subject to sanction.

Random quote: "You don't have to be straight to be in the military; you just have to be able to shoot straight." - Barry Goldwater

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51