Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: January 5472
Next month in: 00:20:03
Server time: 19:39:56, April 19, 2024 CET
Currently online (4): ameerali | burgerboys | LC73DunMHP | Vilnius | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Trudovaja Partija[?]

This page contains information about the Trudovaja Partija.

This party is inactive.

Details

User[?]: Finnsniper

Nation[?]: Trigunskaya Imperiya (Trigunia)

Seats[?] in Императорская Дума; tr. Imperatorskaya Duma (Imperial Duma)[?]: 0

Color[?]:

 

Description[?]:

Trudovaja Partija / Трудовая Партия/ Worker's Party

Political Position: Centre-left
Ideology: Social liberalism, Green left.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistmoderateperfect
Government Responsibilitiesmoderate small governmentmoderateperfect
Marketmoderate laissez-fairemoderateperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate progressivemoderateperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 317874,69940,702,4690.18+0.1801000.00+0
December 3181290,50738,386,4240.76+0.5711001.00+1
December 318429,443,02145,964,26664.06+63.306410064.00+63
December 318728,436,95954,701,98951.99-12.075310053.00-11
December 319029,112,79954,458,98453.46+1.475410054.00+1
December 319327,745,79752,252,61553.10-0.365310053.00-1
December 319627,326,78355,939,34648.85-4.255010050.00-3
December 319926,873,49154,411,22149.39+0.545110051.00+1
December 320224,069,63755,927,14143.04-6.354410044.00-7
December 320521,927,85758,231,34337.66-5.383710037.00-7
December 320824,843,08551,593,43848.15+10.504910049.00+12
December 321112,218,80312,218,803100.00+51.85100100100.00+51
September 32138,437,51625,277,54733.38-66.6235468551.68+254
April 321711,393,51911,393,519100.00+66.62685685100.00+331
April 322211,817,81711,817,817100.00+0.00250250100.00-435
April 322612,112,04112,112,041100.00+0.00250250100.00+0
April 323011,539,22311,539,223100.00+0.00250250100.00+0
August 323356,086,83456,153,48299.88-0.12250250100.00+0
August 32367,399,79029,319,37725.24-74.646125024.40-189
August 323731,241,51147,572,58865.67+40.43507566.67-11
August 324026,093,83545,363,28957.52-8.155610056.00+6
August 324326,882,95646,981,95757.22-0.305710057.00+1
August 324512,123,22512,123,225100.00+42.78100100100.00+43
August 324811,612,98911,612,989100.00+0.00100100100.00+0
August 325111,698,17411,698,174100.00+0.00100100100.00+0
August 325411,448,70611,478,13899.74-0.26100100100.00+0
August 325712,826,79112,826,791100.00+0.26450450100.00+350
August 326012,380,65312,380,653100.00+0.00450450100.00+0
August 326310,737,68510,737,685100.00+0.00450450100.00+0
August 326611,948,45411,948,454100.00+0.00450450100.00+0
August 32691,379,08862,330,6772.21-97.79134502.89-437
August 327221,163,93056,528,57037.44+35.2316945037.56+156
August 32758,903,25261,641,53514.44-23.006445014.22-105
March 327711,088,21355,203,75620.09+5.649145020.22+27
May 328013,322,14454,606,81224.40+4.3111245024.89+21
March 328811,647,72711,647,727100.00+75.607575100.00-37
November 329911,645,11611,645,116100.00+0.00555555100.00+480
May 330012,128,31312,128,313100.00+0.00555555100.00+0
May 330311,358,69711,358,697100.00+0.00450450100.00-105
May 330612,043,25112,043,251100.00+0.00450450100.00+0
May 330912,162,64112,162,641100.00+0.00450450100.00+0
May 331211,856,84611,856,846100.00+0.00450450100.00+0
May 331512,399,34412,399,344100.00+0.00450450100.00+0
May 331811,739,20111,739,201100.00+0.00450450100.00+0
May 332154,480,38254,516,64899.93-0.07450450100.00+0
May 332453,424,14553,471,70099.91-0.02450450100.00+0
May 332754,315,08954,361,41199.91+0.00450450100.00+0
May 333054,644,45354,672,73499.95+0.03450450100.00+0
May 333312,396,26212,396,262100.00+0.05450450100.00+0
May 333612,196,49212,196,492100.00+0.00450450100.00+0
May 333912,169,68712,169,687100.00+0.00450450100.00+0
May 334212,150,19112,150,191100.00+0.00450450100.00+0
December 334511,214,85711,214,857100.00+0.00450450100.00+0
December 33519,481,39344,918,27021.11-78.899745021.56-353
December 335410,884,58647,825,28622.76+1.6510645023.56+9
December 335716,629,77141,663,92939.91+17.1620445045.33+98
January 33609,566,81738,785,34824.67-15.2511245024.89-92
May 336112,044,70112,044,701100.00+75.33750750100.00+638
May 336412,407,00212,407,002100.00+0.00450450100.00-300
May 33677,294,98053,790,89513.56-86.445945013.11-391
May 337314,815,73451,121,91628.98+15.4216655529.91+107
May 337512,100,39151,798,13923.36-5.6213655524.50-30
May 337711,706,36049,897,47623.46+0.1013755524.68+1
February 337911,951,50311,951,503100.00+76.54555555100.00+418
October 338112,076,01812,076,018100.00+0.00200200100.00-355
October 338411,678,09711,678,097100.00+0.00200200100.00+0
October 338711,820,17011,820,170100.00+0.00200200100.00+0
October 339011,621,16911,621,169100.00+0.00200200100.00+0
October 339311,977,19011,977,190100.00+0.00200200100.00+0
October 339611,645,15711,645,157100.00+0.00200200100.00+0
October 339911,446,94011,446,940100.00+0.00200200100.00+0
October 340513,641,77442,302,55432.25-67.756520032.50-135
October 340820,878,83957,066,45336.59+4.347420037.00+9
October 341128,613,77159,539,07448.06+11.479620048.00+22
October 341432,137,40460,762,96452.89+4.8310720053.50+11
October 341731,628,81559,190,95553.44+0.5510820054.00+1
October 342029,234,21757,857,59550.53-2.9110120050.50-7
October 342311,747,37711,747,377100.00+49.47200200100.00+99
October 342611,772,88656,632,92120.79-79.214120020.50-159
October 342927,217,56258,307,60246.68+25.8923350046.60+192
October 343225,186,45050,140,90550.23+3.5525050050.00+17
October 343530,403,38063,740,89647.70-2.5323850047.60-12
October 343830,449,92663,207,73648.17+0.4824250048.40+4
October 344130,927,38461,857,51250.00+1.8225050050.00+8
October 344425,109,45959,332,22942.32-7.6820950041.80-41
June 344728,044,73056,641,51049.51+7.1924850049.60+39
June 345025,343,91252,750,13348.05-1.4723950047.80-9
June 345325,380,02854,098,65446.91-1.1323350046.60-6
February 345511,699,31711,699,317100.00+53.09500500100.00+267
February 345812,445,87812,445,878100.00+0.00200200100.00-300
February 346111,870,93211,870,932100.00+0.00200200100.00+0
February 346426,676,54857,434,20146.45-53.559520047.50-105
February 346733,586,36461,913,23154.25+7.8010920054.50+14
February 347011,112,99911,112,999100.00+45.75200200100.00+91
February 347311,479,75611,479,756100.00+0.00200200100.00+0
February 347611,627,82411,627,824100.00+0.00200200100.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Trudovaja Partija.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423

BillCreatedVoting startedVoteBill StatusResult
Business powers act of 3865May 3865May 3865passed
Budget proposal of May 3865May 3865May 3865passed
Budget proposal of February 3865February 3865February 3865passed
Budget proposal of March 3863March 3863March 3863passed
Budget proposal of December 3862December 3862December 3862passed
Expand powers of the stateNovember 3862April 3863passed
Abolishion of welfareNovember 3862March 3863passed
National mottoNovember 3862November 3862passed
Budget proposal of November 3862November 3862November 3862passed
Ratification of the World Financial Trade Center (WTFC)January 3862January 3862passed
Income tax proposal of May 3861May 3861November 3861passed
Powers of the state expansion act of 3861May 3861November 3861passed
More privatizations actMay 3861November 3861passed
Capital punishment proposal of 3861May 3861November 3861passed
Treaty withdrawal act of 3861May 3861November 3861passed
State religion bill of 3861May 3861November 3861passed
Budget proposal of March 3861March 3861March 3861passed
Income tax proposal of March 3861March 3861March 3861passed
Constitutional reform of 3857November 3857November 3857passed
Emminent domain act of 3857November 3857November 3857passed

Random fact: The voters enjoy active parties who take upon themselves the initiative to create laws.

Random quote: "The Religious Right dislikes both abortions and homosexuality. But who has fewer abortions than gays?" - George Carlin

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51