Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5472
Next month in: 03:00:17
Server time: 04:59:42, April 20, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Golden Keshik/Grno Keshik[?]

This page contains information about the Golden Keshik/Grno Keshik.

This party is inactive.

Details

User[?]: opak_khan

Nation[?]: Pontesi Hanrapetut’yun (Pontesi)

Seats[?] in Պոնտեսիայի Ազգային ժողով (National Assembly of Pontesi)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristclose to noneperfect
Civil Rightsmoderate restrictivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsunknownclose to noneperfect
Government Responsibilitiesmoderate big governmentlimitedperfect
Marketmoderate regulatorclose to noneperfect
Militaryfanatical militaristlimitedperfect
Moralityconservative-leaninglimitedperfect
Religionmoderate religiouslimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 361411,362,74611,362,746100.00+100.00275275100.00+275
April 361511,813,32211,813,322100.00+0.00275275100.00+0
May 361712,387,22312,387,223100.00+0.00275275100.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Golden Keshik/Grno Keshik.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330

BillCreatedVoting startedVoteBill StatusResult
Eminent Domain Act of 4478January 4478April 4482passed
Foreign Aid Act of 4478January 4478November 4480defeated
World Congress General Assembly Presidential ElectionJanuary 4477January 4477passed
Software Patent Act of 4476October 4476October 4476passed
Striking Workers Act of 4476October 4476October 4476passed
Central Bank Oversight Act of 4476October 4476October 4476passed
OOC: Opting back into the Global Role-Play AccordMay 4476May 4476passed
Military Reform of 4475September 4475September 4475passed
Religion Reform of 4475September 4475September 4475passed
RP Bill: Repeal of Anti-World Congress LawsSeptember 4475September 4475passed
Corporation Tax DecreaseNovember 4474November 4474passed
Tuition Act of 4474November 4474November 4474passed
Justice Reform of 4474November 4474November 4474passed
Call for early elections, February 4474February 4474February 4474passed
Civil Liberties Reform of 4472December 4472December 4472passed
Ecology Reform of 4472December 4472December 4472passed
Budget proposal of December 4472December 4472December 4472passed
Income tax proposal of November 4472November 4472November 4472passed
Pontesian Constitutional Reform of 4472September 4472March 4473passed
New Progressive Cabinet ProposalSeptember 4472September 4472passed

Random fact: In cases where players introduce RP laws to a nation and then leave, Moderation reserves the discretion to declare the RP laws void if they appear to have fallen into disuse. In particular, please bear in mind that a player who is inexperienced with Particracy role-play and has joined a nation as the only party there should not generally be expected to abide by RP laws implemented by previous players who have been and left.

Random quote: "I do not believe in the creed professed by the Jewish church, by the Roman church, by the Greek church, by the Turkish church, by the Protestant church, nor by any church that I know of. My own mind is my own church." - Thomas Paine

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51