Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: March 4501
Next month in: 01:08:18
Server time: 22:51:41, December 16, 2018 CET
Currently online (8): 13shinitai | Dalekminator | dannypk2 | DPSDundorf | Farsun | MatthewMinikin | Maxington3 | TrueDignity | Record: 63 on 23:28:53, August 06, 2007 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Hezb-e Awtkhr[?]

This page contains information about the Hezb-e Awtkhr.

This party is inactive.

Details

User[?]: ShahofShahs

Nation[?]: Dowlat-e Keshvar Aldegar (Imperial State of Aldegar)

Seats[?] in The Aldegarian Senate[?]: 0

Color[?]:

 

Description[?]:

Hezb-e Awtkhr, the Party of Glory, is committed to a resurgence of the Aldegarian Republic under the rule of a powerful Shāhanshāh.

Long live the Kasādid dynasty!

OOC: Apologies for bad Farsi. It's going to happen.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate restrictivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistclose to noneperfect
Government Responsibilitiessmall government-leaninglimitedperfect
Marketmoderate laissez-fairelimitedperfect
Militaryextreme pacifistlimitedperfect
Moralitymoderate progressiveclose to noneperfect
Religionmoderate religiousclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 370711,547,66811,547,668100.00+100.00350350100.00+350

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Hezb-e Awtkhr.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474

BillCreatedVoting startedVoteBill StatusResult
Constitutional Reform Act 4500December 4500December 4500voting
Central Bank oversight ActDecember 4500December 4500voting
Cabinet Proposal of October 4500October 4500October 4500passed
Gender Identity ActJuly 4500August 4500voting
Children are the future ActJuly 4500July 4500defeated
Call for early elections, July 4500July 4500July 4500defeated
Civil Code ReformSeptember 4499September 4499passed
Income tax proposal of February 4497February 4497February 4497passed
Budget proposal of February 4497February 4497February 4497passed
National Service ActMarch 4496March 4496passed
Societal Reform Act of 4496March 4496March 4496passed
Expansion of Public Works and Services ActMarch 4496March 4496passed
Abolition of Eminent Domain ActMarch 4496March 4496passed
Cabinet Proposal of June 4495June 4495August 4495passed
Labor Protection Act of 4495May 4495August 4495passed
Call for early elections, April 4495April 4495May 4495passed
Cabinet Proposal of March 4494March 4494March 4494passed
Budget proposal of October 4493October 4493October 4493passed
Income tax proposal of October 4493October 4493October 4493passed
4492 Constitutional ConventionSeptember 4492September 4494passed

Random fact: Cultural Protocols bills must provide descriptions of the cultures, languages and religions which would be easy for an unfamiliar player to understand (eg. "Dundorfian = German"). Where appropriate, they should also provide guidance to players on where to find help with translations and character names. This might include, for example, links to Google Translate, Behind the Name's Random Name Generator and Fantasy Name Generators.

Random quote: "The free market is ugly and stupid, like going to the mall; the unfree market is just as ugly and just as stupid, except there is nothing in the mall, and if you don't go there, they shoot you." P. J. O'Rourke

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 54