Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5460
Next month in: 00:27:22
Server time: 11:32:37, March 28, 2024 CET
Currently online (2): Brazil25 | FireboyUK | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Bloc Libertairé[?]

This page contains information about the Bloc Libertairé.

This party is inactive.

Details

User[?]: Sith.Marauder

Nation[?]: ImÄrat-i AhmÄdÄ«-yi Sahel / Ahmadi Emirate of Solentia (Solentia)

Seats[?] in House[?]: 0

Color[?]:

 

Description[?]:

Bloc Libertairé

"Economic Freedom. Civil Liberty. Personal Responsibility."

The Bloc supports complete freedom in both economic and civil spheres of life. We support capitalism, but believe that some restrictions should be in place to promote the safety and welfare of all of those involved in trade. Above all else, the Bloc supports economic freedom and civil liberty. The Bloc is usually described as a party that supports libertarianism/classical liberalism.

Classical liberalism/libertarianism is the belief that government exists to protect people's rights. Nothing more, nothing less.

As libertarians, we seek a world of liberty; a world in which all individuals are sovereign over their own lives, and no one is forced to sacrifice his or her values for the benefit of others.

We believe that respect for individual rights is the essential precondition for a free and prosperous world, that force and fraud must be banished from human relationships, and that only through freedom can peace and prosperity be realized.

Consequently, we defend each person's right to engage in any activity that is peaceful and honest, and welcome the diversity that freedom brings. The world we seek to build is one where individuals are free to follow their own dreams in their own ways, without interference from government or any authoritarian power.

Our goal is nothing more nor less than a world set free in our lifetime, and it is to this end that we take these stands.

----------------------------------------------------------------------------
The History of the Bloc Libertairé
----------------------------------------------------------------------------

April 2174: The Bloc is formed at a convention of citizens who disapprove of the current government and its political parties. Lucian Lior and Luna Lovegood are elected Bloc Leader and Bloc Chairwoman. They immediately release their manifesto and begin to submit bills to Parliament.

December 2176: After a round of early elections, the Bloc gains 30 seats in Parliament, putting them slightly behind the Neo-Feudalist Party with 32 seats. Bloc Leader Lucian Lior is elected President of the Solentian Republic with 56.90% of the vote. Following the election, the Bloc forms a coalition with the Neo-Feudalist Party, securing 7 Cabinet positions. The following Bloc members are selected to serve in the Cabinet: Fleur Delacour (Foreign Affairs Minister), Draco Lestrange (Justice Minister), Sarah Windsor (Infrastructure and Transport Minister), Emma Watson (Health and Social Services Minister), Topher Greenwood (Food and Agriculture Minister), Rupert Grint (Environment and Tourism Minister), and Lenwë Carnesîr (Trade and Industry Minister).

----------------------------------------------------------------------------
The Bloc Libertairé Manifesto
----------------------------------------------------------------------------

The policies and philosophy of the Bloc are rooted in the priciple that ordinary citizens know best how to lead their own lives.

Freedom of choice lies at the very heart of any civic society. The Bloc fully supports that principle.

It means that we respect a woman's right to choose in abortion.

The Bloc respects the right to choose in education with ideally parents being able to send their children to the school of their choice.

The Bloc supports everyone's right to lead the life thay wish as long as it has no adverse effect on other citizens. We support the gay community and gay rights 100%. We deplore public discrimination on whatever ground. The Bloc fully supports civil liberties for all.

We believe in freedom of religion and freedom from religion. Everybody is free to practice their faith as a matter of private conscience. No individual should be subject to the religious or moral opinions of his neighbors. The state should stay strictly neutral in religious matters and defend the secular nature of the state.

Religious marriage should be replaced by legally recognized civil unions for all couples. Religious marriage should be strictly elective and in no way involved with the state.

We oppose affirmitive action which is a palliative. Instead the Bloc supports full and equal opportunities for all in the field of education and the work place. Once equality of opportunity has been fully implemented as a practical policy, individual merit and individual merit alone should be the sole criteria for advancement.

In order to ensure a level playing field and equality of opportunity in economic policy, the Bloc opposes all monopolies and cartels as obstructing the proper working of the market economy. No corporation should be able to use excessive economic power to distort market competition. Corporate welfare will be ended. Businesses must stand on their own two feet.

The Bloc strongly supports small businesses and cooperative enterprises as a means of securing economic diversity and maximum choice for the consumer.

The Bloc supports free trade with restrictions only to protect the rights of others. We oppose unfair trade practices such as dumping.

As far as possible the Bloc will allow the citizen to make provision for his welfare and health. By using the tax system, we would exempt all payments made by citizens into private social security accounts. The citizen and not the state will decide how his money is invested.

The Bloc supports a limited and multilateral based foreign policy. It is not our duty to be the policeman of the world. We will work more closely with our allies before embarking on unilateral military action.

We pledge to work to provide a strong alternative by restoring the rights that the other parties have stripped from the Solentian People.

Signed,

Lucian Lior
Leader of the Bloc Libertairé

Luna Lovegood
Chairwoman of the Bloc Libertairé

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristhighperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsunknownclose to noneperfect
Government Responsibilitiesextreme small governmentmoderateperfect
Marketmoderate laissez-fairehighperfect
Militarypacifist-leaningclose to noneperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 217427,49540,956,6270.07+0.0701000.00+0
December 217612,685,20042,568,03129.80+29.733010030.00+30
December 21809,637,84740,697,50823.68-6.122510025.00-5

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Bloc Libertairé.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716

BillCreatedVoting startedVoteBill StatusResult
Preventing Foreign Criminals and Terrorism Sanctuary Act of 2968September 3968June 3969passed
Call for early elections, September 3968September 3968September 3968passed
Livestock Farming Act of August 3968August 3968March 3969defeated
Genetically Modified Crops Act of July 3968July 3968March 3969defeated
Fishing Act of July 3968July 3968March 3969defeated
Farm Policy Act of July 3968July 3968March 3969defeated
Withdraw from the Nuclear Non-Proliferation Treaty.June 3968April 3969passed
Defence Act of May 3968May 3968May 3968defeated
Nationalize all Defence IndustriesMay 3968May 3968passed
Whaling Act of May 3968May 3968May 3968defeated
State Housing Act of March 3968March 3968March 3968passed
Public Works Act of March 3968March 3968March 3968passed
Post Office Act of March 3968March 3968March 3968defeated
Nuclear Power Act of March 3968March 3968March 3968defeated
Region Energy Grids Act of March 3968March 3968March 3968passed
Energy Generation Act of March 3968March 3968March 3968passed
Eminent Domain Compensation Act of March 3968March 3968March 3968passed
Eminent Domain Act of March 3968March 3968March 3968defeated
Travel Act of March 3968March 3968March 3968defeated
Refugee Policy Act of March 3968March 3968March 3968defeated

Random fact: The grey space in the east is populated by the forum-based countries, known in-game as the former colonies or the "Third World". These countries are managed by the Third World Coordinator but players can request control of individual countries in the Third World Control Requests thread: http://forum.particracy.net/viewtopic.php?f=11&t=8302

Random quote: "There are four boxes to be used in defense of liberty: soap, ballot, jury, and ammo. Please use in that order." - Ed Howdershelt

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51