Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5471
Next month in: 02:56:07
Server time: 01:03:52, April 19, 2024 CET
Currently online (2): ameerali | hexaus18 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Conservative Monarchist Party[?]

This page contains information about the Conservative Monarchist Party.

This party is inactive.

Details

User[?]: anonimanonim4888

Nation[?]: Fürstentum vu Kéimun (Keymon)

Seats[?] in Chamber of Deputéiert / Abgeordnetenkammer / Camera di i Deputati (Chamber of Deputies)[?]: 0

Color[?]:

 

Description[?]:

Conservative Monarchist Party

Motto:" Pax et Bonum"

Political Lean: Right
Political objectives: -to ensure a morally strong nation
-to protect life and traditional family
-to represent the Church
-to be sure that Keymon will be a monarchy
Party leader: Rector de Thálassa, Foréas de Novem Klaves, et Praefectus de Sfaíres Eius Regis Ypsilótita Rex Marcus Tiberius I (Ruler of the Sea, Bearer of the Nine Keys and Commander of the Realms His Royal Highness King Marcus Tiberius I) .

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistlimitedperfect
Government Responsibilitiesmoderate small governmenthighperfect
Marketmoderate laissez-fairehighperfect
Militarypacifist-leaningmoderateperfect
Moralitymoderate conservativemoderateperfect
Religionmoderate religiousmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 41272,56112,030,6510.02+0.0203450.00+0
February 41311,185,05812,084,1829.81+9.79333459.57+33
February 41351,312,82611,369,29511.55+1.744034511.59+7
February 41383,776,9804,847,55577.92+66.3726934577.97+229
April 41393,033,5896,452,92447.01-30.9016234546.96-107
April 41433,315,2196,758,59449.05+2.0416934548.99+7
April 41471,093,17410,164,60210.75-38.303734510.72-132
April 41511,102,1858,059,10113.68+2.924734513.62+10
April 41554,062,9128,294,48348.98+35.3116934548.99+122
April 41593,481,0488,832,68039.41-9.5713634539.42-33
April 41633,829,2938,184,53546.79+7.3816134546.67+25
April 41673,513,4807,102,67349.47+2.6817134549.57+10
December 41702,408,7952,408,795100.00+50.53345345100.00+174
December 41762,521,10211,043,70322.83-77.177834522.61-267
December 41794,010,42911,445,19935.04+12.218023034.78+2
December 41823,768,69611,489,65232.80-2.247523032.61-5
December 41853,878,07211,118,15034.88+2.088023034.78+5
December 41883,893,31611,303,41234.44-0.447923034.35-1
December 41913,957,12812,604,94731.39-3.057223031.30-7
December 41947,638,32113,468,13156.71+25.3213123056.96+59
December 41974,602,4109,457,41548.66-8.0511223048.70-19
December 42003,622,2018,747,36041.41-7.269523041.30-17
December 42031,993,52912,092,29816.49-24.923823016.52-57
January 42053,529,44111,495,34330.70+14.227123030.87+33
January 42083,205,16812,597,43025.44-5.265923025.65-12
July 42083,635,53112,098,92230.05+4.616923030.00+10
July 42113,531,74611,647,77630.32+0.277023030.43+1
July 42143,587,57111,456,07831.32+0.997223031.30+2
July 42173,203,78211,421,90928.05-3.276523028.26-7
July 42203,307,7699,133,13436.22+8.178323036.09+18
July 42233,609,9108,959,21840.29+4.089323040.43+10
July 42263,455,6088,419,32241.04+0.759423040.87+1
July 42293,106,8718,246,84337.67-3.378723037.83-7
July 42323,308,8938,739,40737.86+0.198723037.83+0
July 42353,123,8978,020,85138.95+1.098923038.70+2
July 42362,360,8812,360,881100.00+61.05230230100.00+141
July 42392,215,5442,215,544100.00+0.00750750100.00+520
July 42422,009,32311,129,52818.05-81.9513575018.00-615
July 42453,762,20112,691,55529.64+11.5920168029.56+66
December 42478,096,9928,111,03799.83+70.1867968099.85+478
December 42508,530,8238,543,36399.85+0.03680680100.00+1
December 42531,496,61311,030,06413.57-86.289268013.53-588
December 42563,354,76811,523,72629.11+15.5419868029.12+106
December 42593,344,29911,771,27528.41-0.7019368028.38-5
December 42622,990,3949,268,72032.26+3.8521968032.21+26
December 42652,875,4769,436,42530.47-1.7920768030.44-12
December 42682,801,5458,940,25131.34+0.8621368031.32+6
December 42712,737,9239,110,11630.05-1.2820468030.00-9
December 42742,630,1008,512,95630.90+0.8421068030.88+6
December 42772,671,0964,532,99258.93+28.0340168058.97+191
December 42807,316,3347,563,74096.73+37.8065868096.76+257
December 42838,349,8228,361,95699.85+3.13680680100.00+22
December 42862,530,9592,545,69199.42-0.4367768099.56-3
December 42892,179,4782,185,53999.72+0.3046446599.78-213
December 42922,641,5422,641,542100.00+0.28465465100.00+1
December 42952,180,0332,181,62399.93-0.07465465100.00+0
December 42982,292,0022,301,67599.58-0.3546446599.78-1
December 4301999,2052,243,90444.53-55.0520746544.52-257
December 4304933,2252,557,74836.49-8.0417046536.56-37
December 43071,267,0242,581,98449.07+12.5922846549.03+58
December 4311927,6772,289,52440.52-8.5518846540.43-40
December 4315747,1932,547,50129.33-11.1913646529.25-52
December 43194,083,06611,332,66436.03+6.7016746535.91+31
December 43232,117,0866,351,94933.33-2.7015546533.33-12
December 43271,658,2376,126,45927.07-6.2612646527.10-29
December 43312,586,7968,520,32730.36+3.2914146530.32+15
December 43373,737,3478,045,73646.45+16.0921646546.45+75
June 43422,218,0787,966,24127.84-18.6112946527.74-87
June 4347910,7468,532,60710.67-17.174946510.54-80
June 43523,965,9889,887,18740.11+29.4418746540.22+138
June 43573,829,7657,899,62648.48+8.3722646548.60+39
November 43583,747,09512,600,99829.74-18.7413946529.89-87
November 43612,850,9866,565,95343.42+13.6820246543.44+63
April 43663,506,3705,163,43667.91+24.4931646567.96+114
April 4370775,5308,505,9609.12-58.79181999.05-298
April 43712,881,3915,635,41051.13+42.0110219951.26+84
April 43743,203,9137,515,25342.63-8.508519942.71-17

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Conservative Monarchist Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425

BillCreatedVoting startedVoteBill StatusResult
Luxury and Essential Needs Tax Change Act of 4503November 4503November 4503passed
Ratification of the General Trade Agreement with Dankuk(Authorizes Trade with Dankuk)September 4503September 4503passed
Ratification of the Luthorian-Keymonite Free Trade AgreementFebruary 4502February 4502passed
WMD Act of 4501May 4501September 4501passed
Abolishing Paramilitaries Act of 4501May 4501September 4501passed
.May 4501September 4501passed
Bill: OOC/RP: Cultural Protocols (ALL PLAYERS PLEASE READ)February 4500January 4762passed
OOC:City Name ChangesFebruary 4500February 4500passed
OOC: Further name changes related to the new cultural protocolFebruary 4500February 4500passed
OOC:Name Change ProposalFebruary 4500February 4500passed
Bill: OOC/RP: Cultural Protocols (ALL PLAYERS PLEASE READ)February 4500February 4500defeated
Cultural Protocol ProposalJanuary 4497September 4497passed
Removal of Cultural ProtocolsJanuary 4496January 4496passed
OOC: Cultural Protocol ProposalOctober 4492September 4493passed
Eminent Domain Act of 4488April 4488April 4488passed
Budget proposal of October 4486October 4486October 4486passed
Establishment of a Trade Embargo On DankukSeptember 4486September 4486passed
Ratification of the [*SECRET TREATY*]Treaty of Military Assistance Between Vanuku and KeymonMay 4484May 4484passed
Cabinet Proposal of April 4483April 4483April 4483passed
Ratification of the Diplomatic Recognition of the Isle of Sutton as a Crown Dependency of the Commonwealth of HutoriJanuary 4482January 4482passed

Random fact: When it comes to creating a Cultural Protocol in a Culturally Open nation, players are not necessarily required to provide a plausible backstory for how the nation's cultural background developed. However, the provision of a plausible backstory may be a factor in whether Moderation approves the Cultural Protocol if players in surrounding nations question its appropriateness for their region of the game map.

Random quote: "I do not believe in the creed professed by the Jewish church, by the Roman church, by the Greek church, by the Turkish church, by the Protestant church, nor by any church that I know of. My own mind is my own church." - Thomas Paine

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51