Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: February 5474
Next month in: 03:37:38
Server time: 20:22:21, April 23, 2024 CET
Currently online (4): AethanKal | hexaus18 | Mity1 | rezins | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Nasionale Konserwatiewe Party[?]

This page contains information about the Nasionale Konserwatiewe Party.

This party is inactive.

Details

User[?]: mechajerm

Nation[?]: Federale Republiek van Seridjan (Saridan)

Seats[?] in Volksraad (People's Council)[?]: 0

Color[?]:

 

Description[?]:

We support the principles of nationalism and conservatism as a founding bulwark against the forces of cultural metzism.

We are opposed to mass immigration and multiculturalism. We espouse patriotism of our nation's rich cultural heritage.

We support free market capitalism, small government ideals, and conservative family values.

We support a strong national defence force, and law and order policies that strike fear into the hearts of criminals.

Political position: Right-Wing

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsconvinced restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced isolationistlimitedperfect
Government Responsibilitiesmoderate small governmentmoderateperfect
Marketconvinced laissez-fairemoderateperfect
Militaryconvinced militaristlimitedperfect
Moralityconvinced conservativehighperfect
Religionmoderate religiousmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 41479,623,51961,368,21315.68+15.682817516.00+28
October 41485,892,87358,240,22610.12-5.561817510.29-10
October 41525,932,75057,953,07810.24+0.121917510.86+1
October 41538,419,97556,911,35414.79+4.562617514.86+7
October 415719,904,54256,841,80335.02+20.226117534.86+35
October 416119,059,08764,179,63129.70-5.325217529.71-9
October 416513,039,37560,595,31421.52-8.183817521.71-14
January 416613,169,96961,495,30321.42-0.103817521.71+0
January 41709,147,32561,092,38114.97-6.444127514.91+3
January 417412,909,21861,922,00620.85+5.875727520.73+16
April 417617,623,77658,044,65730.36+9.518227529.82+25
April 418018,820,50855,608,99333.84+3.489127533.09+9
April 418417,928,15554,480,10732.91-0.948927532.36-2
April 418817,240,61656,468,36630.53-2.388127529.45-8
August 418922,745,54545,652,38649.82+19.2913727549.82+56
August 419325,858,78948,834,32252.95+3.1314327552.00+6
August 419732,257,57461,275,06352.64-0.3114527552.73+2
August 420112,314,06452,902,67423.28-29.376527523.64-80

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Nasionale Konserwatiewe Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392

BillCreatedVoting startedVoteBill StatusResult
Income tax proposal of February 3378February 3378February 3378passed
Reform Bill of 3378February 3378February 3378passed
Cabinet Proposal of July 3376July 3376July 3376passed
Energy and TOC Administration: State over PrivateMay 3376October 3377defeated
Red BillMay 3373May 3373defeated
Cabinet Proposal of December 3372December 3372May 3373defeated
Motion for the Renaming of the ParliamentNovember 3372May 3376passed
Revision Act No.4January 3371January 3371defeated
Red ProposalMay 3370June 3370defeated
Reform Bill of 3369June 3369June 3369passed
Reform Bill 3365November 3365November 3365passed
Revision Act No.3April 3365April 3368passed
Revision Act No.2December 3363July 3364passed
Red proposalNovember 3363September 3364defeated
Budget proposal of November 3363November 3363November 3363passed
Eminent Domain ReformJanuary 3362January 3362passed
ReformsNovember 3361May 3362passed
Revision Act No.1November 3361November 3361passed
Red ProposalNovember 3361November 3361defeated
Ratification of the Openning An Embassy in Jakania PolicyMay 3361May 3361defeated

Random fact: Character names must appear plausible and should consist of at least a first name and a surname. Exceptions to this will only be granted at Moderation's discretion and where a very strong case has been presented

Random quote: "Someone who wields power in name only can never compete with those who wield it through action." - Franz Reichert, former Luthorian politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51