Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: January 5472
Next month in: 00:31:39
Server time: 19:28:20, April 19, 2024 CET
Currently online (4): Interstellar. | LC73DunMHP | Moderation | Vilnius | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Nasionale Konserwatiewe Party[?]

This page contains information about the Nasionale Konserwatiewe Party.

This party is inactive.

Details

User[?]: mechajerm

Nation[?]: Federale Republiek van Seridjan (Saridan)

Seats[?] in Volksraad (People's Council)[?]: 0

Color[?]:

 

Description[?]:

We support the principles of nationalism and conservatism as a founding bulwark against the forces of cultural metzism.

We are opposed to mass immigration and multiculturalism. We espouse patriotism of our nation's rich cultural heritage.

We support free market capitalism, small government ideals, and conservative family values.

We support a strong national defence force, and law and order policies that strike fear into the hearts of criminals.

Political position: Right-Wing

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsconvinced restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced isolationistlimitedperfect
Government Responsibilitiesmoderate small governmentmoderateperfect
Marketconvinced laissez-fairemoderateperfect
Militaryconvinced militaristlimitedperfect
Moralityconvinced conservativehighperfect
Religionmoderate religiousmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 41479,623,51961,368,21315.68+15.682817516.00+28
October 41485,892,87358,240,22610.12-5.561817510.29-10
October 41525,932,75057,953,07810.24+0.121917510.86+1
October 41538,419,97556,911,35414.79+4.562617514.86+7
October 415719,904,54256,841,80335.02+20.226117534.86+35
October 416119,059,08764,179,63129.70-5.325217529.71-9
October 416513,039,37560,595,31421.52-8.183817521.71-14
January 416613,169,96961,495,30321.42-0.103817521.71+0
January 41709,147,32561,092,38114.97-6.444127514.91+3
January 417412,909,21861,922,00620.85+5.875727520.73+16
April 417617,623,77658,044,65730.36+9.518227529.82+25
April 418018,820,50855,608,99333.84+3.489127533.09+9
April 418417,928,15554,480,10732.91-0.948927532.36-2
April 418817,240,61656,468,36630.53-2.388127529.45-8
August 418922,745,54545,652,38649.82+19.2913727549.82+56
August 419325,858,78948,834,32252.95+3.1314327552.00+6
August 419732,257,57461,275,06352.64-0.3114527552.73+2
August 420112,314,06452,902,67423.28-29.376527523.64-80

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Nasionale Konserwatiewe Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392

BillCreatedVoting startedVoteBill StatusResult
Ecological BillJanuary 2228August 2228defeated
Child Molestation BillJanuary 2228August 2228passed
Marriage BillJanuary 2228August 2228defeated
Class War BillJanuary 2228August 2228defeated
Fish Nationalisation BillJanuary 2228August 2228passed
Tighter Rules BillJanuary 2228August 2228passed
Spanking BillJanuary 2228August 2228passed
Changing the name of the nationJanuary 2228January 2228passed
Eminent Domain PolicyDecember 2227December 2227defeated
Private Mail Carrier Regulation ActDecember 2227December 2227passed
Public Higher Education ActDecember 2227December 2227passed
Regulation ReductionNovember 2227November 2227defeated
International AidNovember 2227November 2227passed
Privitizing Television and RadioNovember 2227November 2227defeated
LSA Religion BillNovember 2227November 2227defeated
Budget proposal of October 2227October 2227February 2228defeated
Income tax proposal of October 2227October 2227February 2228defeated
TaxesOctober 2227October 2227passed
Abortion BillAugust 2227January 2228passed
Civil Service Reform BillAugust 2227January 2228passed

Random fact: Cultural Protocols should generally be reflective of RP conducted within the nation and should not significantly alter or modify the ethnic, religious or linguistic composition without considerable and reasonable role-play or other justification.

Random quote: "You can't give the government the power to do good without also giving it the power to do bad, in fact, to do anything it wants." - Harry Browne

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51