Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5460
Next month in: 01:25:48
Server time: 10:34:11, March 28, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Freedom Party[?]

This page contains information about the Freedom Party.

This party is inactive.

Details

User[?]: derrick0042

Nation[?]: Workers' and Peasants' Ahmadi Emirate of Talmoria (Talmoria)

Seats[?] in Protectorate Assembly[?]: 0

Color[?]:

 

Description[?]:

The Freedom Party aims to provide liberties for all citizens while building national pride and values.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsconvinced permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsextreme internationalistclose to noneperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketmoderate regulatormoderateperfect
Militaryunknownclose to noneperfect
Moralityconservative-leaninglimitedperfect
Religionsecular-leaningclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 41572,226,15463,046,6903.53+3.53185003.60+18
June 41572,476,39661,462,3254.03+0.50215004.20+3
June 41585,055,98060,041,6638.42+4.39425008.40+21
January 41604,805,65057,196,6738.40-0.02415008.20-1

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Freedom Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261

BillCreatedVoting startedVoteBill StatusResult
Eminent Domain Policies Reform BillMarch 3012March 3012passed
Declaration of War to TriguniaDecember 3011December 3011passed
Cabinet Proposal of October 3011 - Second National Cabinet of the Republic of TalmoriaOctober 3011October 3011passed
Ratification of the Terran Emanicpation BillJuly 3011October 3011passed
Child Benefit Estabilishment BillJune 3011October 3011passed
Social Security Estabilishment BillJune 3011October 3011passed
Minimum Income Benefit BillJune 3011October 3011passed
Religious Liberty Reform BillJune 3011October 3011passed
Civil Liberties Reform ActDecember 3010December 3010passed
National Health System Reform BillDecember 3010December 3010passed
Professional Retirement Age Reduction BillMay 3009May 3009passed
National Military System Reform BillOctober 3008October 3008passed
Second National Symbols Reform BillOctober 3008October 3008passed
National Justice System Reform BillApril 3008April 3008passed
Budget Policy Replacement ProposalNovember 3007November 3007passed
Income Tax Policy Replacement ProposalNovember 3007November 3007passed
Republic of Talmoria ActNovember 3007November 3007passed
National Symbols Reform BillNovember 3007November 3007passed
Steel Cabinet Proposal of October 3007October 3007October 3007passed
Cabinet Proposal of May 3007May 3007May 3007defeated

Random fact: Players are expected to play the game independently and should not share their passwords or allow others to access their accounts.

Random quote: "We need a new environmental consciousness on a global basis. To do this, we need to educate people." - Mikhail Gorbachev

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51