Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5456
Next month in: 03:25:57
Server time: 12:34:02, March 19, 2024 CET
Currently online (1): Tayes3 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Federation Under Crazy Killers -- United[?]

This page contains information about the Federation Under Crazy Killers -- United.

This party is inactive.

Details

User[?]: orayole

Nation[?]: Tælmörksríki / Kingdom of Telamon (Telamon)

Seats[?] in Landsthingi (National Assembly)[?]: 0

Color[?]:

 

Description[?]:



Government big enough to supply everything you need is big enough to take everything you have ... The course of history shows that as a government grows, liberty decreases.
Thomas Jefferson

Although it is not true that all conservatives are stupid people, it is true that most stupid people are conservative.
~ John Stuart Mill

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaninglimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate small governmentclose to noneperfect
Marketregulator-leaninglimitedperfect
Militaryconvinced militaristlimitedperfect
Moralitymoderate progressivelimitedperfect
Religionextreme secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 20692,304,14319,944,40011.55+11.553625014.40+36
April 20711,857,47618,909,9919.82-1.732725010.80-9
July 20722,361,96620,879,78411.31+1.493525014.00+8
July 20741,905,46320,816,5869.15-2.162725010.80-8
July 20763,798,39722,049,44217.23+8.075025020.00+23
July 20784,715,54622,321,40621.13+3.905925023.60+9
July 20804,691,36822,445,94720.90-0.226025024.00+1
July 20824,985,00622,573,32122.08+1.186125024.40+1
July 20845,769,62115,065,97438.30+16.219625038.40+35
September 20865,826,75813,440,71443.35+5.0610625042.40+10
September 20883,132,71913,435,96823.32-20.046925527.06-37
September 20904,561,78620,884,05221.84-1.475925523.14-10
September 20923,571,74121,749,86316.42-5.424325516.86-16
March 20932,936,76919,805,15014.83-1.594125516.08-2
March 20953,003,37522,542,38613.32-1.513425513.33-7
March 20973,664,71723,489,16115.60+2.284325516.86+9
March 20993,247,69019,490,58316.66+1.064525517.65+2
March 21012,526,45318,248,12713.84-2.823625514.12-9
March 21032,844,56618,374,51715.48+1.644125516.08+5
March 21052,555,06318,007,05814.19-1.293825514.90-3
March 21072,526,09016,415,18915.39+1.204025515.69+2
March 21093,200,23520,601,80815.53+0.154225516.47+2
March 21113,792,52524,993,16015.17-0.364025515.69-2
March 21133,843,96225,008,54115.37+0.203825514.90-2
March 21153,111,61724,915,90012.49-2.883225512.55-6
March 21173,591,08224,600,28714.60+2.113825514.90+6
March 21193,982,16623,509,97716.94+2.344525517.65+7
March 21213,617,94422,659,96215.97-0.974225516.47-3
March 21233,245,98623,751,23213.67-2.303625514.12-6
September 21253,816,05524,510,47215.57+1.904225516.47+6
March 21283,088,63225,416,72012.15-3.423425513.33-8
September 21302,562,25826,761,5969.57-2.582625510.20-8
March 21334,180,75826,983,12115.49+5.924225516.47+16
September 21353,694,57726,234,29014.08-1.413725514.51-5
March 21384,248,07426,727,86215.89+1.814425517.25+7
September 21403,181,42328,257,84511.26-4.643025511.76-14
March 21435,593,66629,640,49418.87+7.615025519.61+20
September 2145000.00-18.87252559.80-25
January 21461,667,10914,999,62711.11+11.113025511.76+5
July 21483,569,93527,578,82112.94+1.833525513.73+5
January 21512,697,65427,024,9919.98-2.96252559.80-10
July 21532,464,10328,116,0948.76-1.22222558.63-3
January 21562,626,12328,092,9819.35+0.58252559.80+3
July 21583,526,81532,476,55910.86+1.512925511.37+4
January 21613,111,51132,206,5109.66-1.20252559.80-4
April 21683,373,11335,680,8949.45-0.21333559.30+8
October 21703,488,66134,935,3339.99+0.53353559.86+2
April 21733,745,81134,422,51810.88+0.904035511.27+5
May 21733,586,18135,103,72410.22-0.673635510.14-4
November 21754,625,12735,283,93613.11+2.894735513.24+11
May 21781,319,64936,352,1113.63-9.48133553.66-34
November 21801,268,67736,245,8853.50-0.13113553.10-2
May 21832,804,93735,942,9417.80+4.30273557.61+16
November 21852,972,91134,661,7808.58+0.77303558.45+3
May 21882,936,99336,479,8808.05-0.53283557.89-2
November 21903,149,18436,714,5618.58+0.53303558.45+2
May 21931,812,65537,088,2584.89-3.69163554.51-14
November 21951,407,02438,692,9203.64-1.25113553.10-5
May 21983,154,00538,154,9378.27+4.63283557.89+17
November 22003,161,60038,805,8818.15-0.12293558.17+1
May 220340,13238,294,1550.10-8.0403550.00-29
November 220525,00838,061,4090.07-0.0403550.00+0
May 220826,74037,449,0530.07+0.0103550.00+0
November 221029,62041,076,1500.07+0.0003550.00+0
April 239232,16768,437,3090.05-0.0306010.00+0
April 23947,735,82061,652,37212.55+12.507560112.48+75
June 23947,911,70563,728,17512.41-0.137560112.48+0
June 23968,176,31957,016,85514.34+1.938760114.48+12
June 23987,188,96956,341,09612.76-1.587660112.65-11
June 24006,496,18860,022,11010.82-1.946660110.98-10
June 24028,518,85661,756,67513.79+2.978560114.14+19
June 24047,509,13460,634,30012.38-1.417660112.65-9
June 24067,660,60467,609,76911.33-1.056960111.48-7
June 24087,779,47765,508,16911.88+0.547160111.81+2
June 24109,553,91771,497,41613.36+1.498060113.31+9
August 24125,042,49676,448,5626.60-6.77386016.32-42
August 24146,259,04275,694,9688.27+1.67486017.99+10
August 24165,270,17879,107,2576.66-1.61396016.49-9
August 24184,012,04576,344,0115.26-1.41306014.99-9
August 24204,614,19576,317,0706.05+0.79356015.82+5
August 24225,100,89275,732,4186.74+0.69396016.49+4
August 24246,112,10180,511,4887.59+0.86466017.65+7
August 24264,724,10581,225,2645.82-1.78336015.49-13
August 24284,915,32377,361,0776.35+0.54366015.99+3
August 24305,052,27878,707,4336.42+0.07376016.16+1
August 24325,485,33878,098,9367.02+0.60416016.82+4
August 24346,040,41277,574,1337.79+0.76456017.49+4
August 24368,963,75176,673,79311.69+3.906960111.48+24
August 243810,968,47474,647,25414.69+3.008860114.64+19
August 24445,928,32984,710,3567.00-7.704755.33-84
October 24475,229,83783,331,6746.28-0.72447505.87+40
October 24501,606,16981,572,5281.97-4.31127501.60-32
March 24512,064,30879,511,9182.60+0.63177502.27+5
March 24545,989,61285,709,1746.99+4.39517506.80+34

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Federation Under Crazy Killers -- United.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560

BillCreatedVoting startedVoteBill StatusResult
INF Health ReformSeptember 2564December 2564defeated
INF Eminent Domain Policy ReformSeptember 2564September 2564defeated
INF Housing ReformSeptember 2564September 2564passed
COM Update Telamon-Lodamun Friendship Treaty & Telamon Mutual Defense PactAugust 2564January 2565passed
COM Define NationalityAugust 2564January 2565defeated
COM Retirement AgeAugust 2564January 2565passed
COM Legislative SessionAugust 2564January 2565defeated
COM Enact Telamon-Likatonia Non Aggression PactAugust 2564August 2564passed
Capitalist Omnibus BillJuly 2564July 2564defeated
Pre-school Privatization BillJune 2564November 2565passed
Military Service CompromiseJune 2564November 2564passed
COM More Representative ParliamentMay 2564August 2564defeated
COM Defense PreparationsMay 2564August 2564passed
The Right to StrikeMay 2563December 2563passed
COM Prison Work Reform BillMay 2563May 2563defeated
Undermining the Communist AgendaMay 2563May 2563defeated
COM Foreign Policy Cooperative ReformApril 2563June 2563passed
COM Protect Telamonian IndustryApril 2563April 2563defeated
Constitutional Rightful Amendment (RRP)March 2563March 2563defeated
Weaponry reform (RRP)March 2563March 2563passed

Random fact: To see what other nations are up to and to actively involve yourself in international activities: check the Roleplaying section on the forum! Don't be shy to make a news post about your party's recent achievements.

Random quote: "Victory attained by violence is tantamount to a defeat, for it is momentary." - Mahatma Gandhi

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51