Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5472
Next month in: 03:27:17
Server time: 04:32:42, April 20, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Unia Walruzyjskich Konserwatystów[?]

This page contains information about the Unia Walruzyjskich Konserwatystów.

This party is inactive.

Details

User[?]: Wilderberg IV

Nation[?]: Technokratyczna Republika Valruzia (Valruzia)

Seats[?] in Narodowe Zgromadzenie Doradcze Walruzyjskiej Ligi Socjalistycznej[?]: 0

Color[?]:

 

Description[?]:

Luthorian: The Union of Valruzian Conservatives
Valruzian: Unia Walruzyjskich Konserwatystów
"Czas na zmianę!" "Time for a change!"

𝐈𝐃𝐄𝐎𝐋𝐎𝐆𝐘:
- Economic conservatism,
- Liberal conservatism,
- Support of LGBT rights and IVF,
- Opposition to abortion,
- Support for stronger military and diplomacy.

𝐒𝐏𝐄𝐂𝐓𝐑𝐔𝐌 𝐏𝐎𝐒𝐈𝐓𝐈𝐎𝐍: centre-right to right-wing

𝐏𝐀𝐑𝐓𝐘 𝐆𝐎𝐕𝐄𝐑𝐍𝐀𝐍𝐂𝐄:
Party Leader: Karol Krukowiecki

Associated Groups: Conservative Youth Forum, Conservative Students' Union

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsmoderate permissiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsextreme internationalistlimitedperfect
Government Responsibilitiesmoderate small governmentexcellentperfect
Marketmoderate laissez-faireexcellentperfect
Militaryextreme militaristclose to noneperfect
Moralityconservative-leaningmoderateperfect
Religionmoderate religioushighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 429316,865,80252,642,97632.04+32.0415246532.69+152
October 429429,726,00056,264,02652.83+20.7924646552.90+94
October 429826,460,57854,052,03848.95-3.8822746548.82-19

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Unia Walruzyjskich Konserwatystów.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400

BillCreatedVoting startedVoteBill StatusResult
Ratification of the The Law of the SeaOctober 4297October 4297yespassedwon
Ratification of the Istalian Embassy Diplomatic Relations TreatyMay 4297May 4297yespassedwon
Budget proposal of March 4297March 4297March 4297yespassedwon
Ratification of the Selucian Official Diplomatic TreatyNovember 4296May 4297yespassedwon
Ratification of the Official Diplomatic Treaty of the Republic of ValruziaNovember 4296November 4296yespassedwon
Ratification of the Official Diplomatic Treaty of the Republic of ValruziaJune 4295June 4295yesdefeatedlost
Ratification of the Anti Slavery TreatyDecember 4294December 4294yespassedwon
Homeless Shelter Act of February 4296 - Ustawa o Schroniskach dla Bezdomnych, Luty 4296November 4294February 4296yespassedwon
Eminent Domain Act of October 4295 - Ustawa o Wywłaszczeniu, Październik 4295November 4294October 4295yespassedwon
Anti-Slavery Embargoes Act of June 4295 - Ustawa o Embargach Anty-Niewolniczych, Czerwiec 4295November 4294June 4295yespassedwon
Postal Bill of March 4295 - Ustawa o Poczcie, Marzec 4295November 4294March 4295yespassedwon
Energy Act of March 4295 - Ustawa Energetyczna, Marzec 4295November 4294March 4295yespassedwon
Ratification of the League of Anti-Slavery NationsNovember 4294December 4294yesdefeatedlost
Ratification of the International Rejection of Slavery AgreementNovember 4294December 4294yesdefeatedlost
Ratification of the The International Ban on SlaveryNovember 4294December 4294yesdefeatedlost
Ratification of the Selucian Official Diplomatic TreatyNovember 4294December 4294yesdefeatedlost
Anti-Socialist Welfare Policy Act of November 4294 - Ustawa o Anty-Socjalistycznej Polityce Socjalnej, Listopad 4294November 4294November 4294yespassedwon
Incestuous Acts Bill of November 4294 - Ustawa o Aktach Kazirodczych, Listopad 4294November 4294November 4294yespassedwon
Foreign Marriages Bill of November 4294 - Ustawa o Zagranicznych Małżeństwach, Listopad 4294November 4294November 4294yespassedwon
Security Council Nominations - Nominacje do Rady BezpieczeństwaOctober 4294October 4294yespassedwon

Random fact: Treaties will be eligible for deletion if they are more than 50 in-game years old and have no currently ratified members.

Random quote: "The Religious Right dislikes both abortions and homosexuality. But who has fewer abortions than gays?" - George Carlin

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51