Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5474
Next month in: 02:30:51
Server time: 01:29:08, April 25, 2024 CET
Currently online (2): ADM Drax | Kubrick2 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Our Motherland[?]

This page contains information about the Our Motherland.

This party is inactive.

Details

User[?]: Jalapeño

Nation[?]: Trigunskaya Imperiya (Trigunia)

Seats[?] in Императорская Дума; tr. Imperatorskaya Duma (Imperial Duma)[?]: 0

Color[?]:

 

Description[?]:

Wiki page: http://particracy.wikia.com/wiki/Our_Motherland

Ideology:
- Center-right
- Classical liberalism
- Patriotism
- Austrian School of Economics
- Liberal conservadurism
- Pro-decentralization
- Pro-globalism

Yuri Kruchov (4311-4316)

Yuri Kruchov is an economist and politician with a doctorate in Economics given by the University of Rodshyadam.
With Kruchov, the political party Our Motherland was formed, setting liberty and moderation as the main values of the new political formation. Kruchov managed to be elected president the December of 4312 (4312-4313) and in May of 4313 (4313-4316).
(Image: https://pbs.twimg.com/profile_images/456353136148377601/j9IsCOnt.jpeg )

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate federalisthighperfect
Civil Rightspermissive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiesmoderate small governmenthighperfect
Marketregulator-leaningmoderateperfect
Militarymoderate militaristmoderateperfect
Moralitymoderate progressivehighperfect
Religionconvinced secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 43127,282,73064,301,92911.33+11.336255511.17+62
May 43137,522,25663,672,88511.81+0.496455511.53+2
May 43166,571,30755,077,22611.93+0.128975011.87+25
May 43194,812,98656,927,1368.45-3.48637508.40-26
May 43227,020,18254,676,33212.84+4.389575012.67+32
May 43257,567,69958,003,66113.05+0.219775012.93+2
May 43287,928,97356,529,24614.03+0.9810475013.87+7
May 433114,054,49253,973,05226.04+12.0119275025.60+88
May 433414,477,21648,755,48829.69+3.6522275029.60+30
May 433732,387,89766,218,18648.91+19.2236775048.93+145
May 434010,202,11866,482,89215.35-33.5711575015.33-252
May 434314,202,30063,099,00722.51+7.1617075022.67+55
May 434618,881,93160,181,78831.37+8.8723875031.73+68

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Our Motherland.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423

BillCreatedVoting startedVoteBill StatusResult
Business powers act of 3865May 3865May 3865passed
Budget proposal of May 3865May 3865May 3865passed
Budget proposal of February 3865February 3865February 3865passed
Budget proposal of March 3863March 3863March 3863passed
Budget proposal of December 3862December 3862December 3862passed
Expand powers of the stateNovember 3862April 3863passed
Abolishion of welfareNovember 3862March 3863passed
National mottoNovember 3862November 3862passed
Budget proposal of November 3862November 3862November 3862passed
Ratification of the World Financial Trade Center (WTFC)January 3862January 3862passed
Income tax proposal of May 3861May 3861November 3861passed
Powers of the state expansion act of 3861May 3861November 3861passed
More privatizations actMay 3861November 3861passed
Capital punishment proposal of 3861May 3861November 3861passed
Treaty withdrawal act of 3861May 3861November 3861passed
State religion bill of 3861May 3861November 3861passed
Budget proposal of March 3861March 3861March 3861passed
Income tax proposal of March 3861March 3861March 3861passed
Constitutional reform of 3857November 3857November 3857passed
Emminent domain act of 3857November 3857November 3857passed

Random fact: The players in a nation have a collective responsibility to ensure their "Bills under debate" section is kept in good order. Bills which are irrelevant or have become irrelevant should be deleted. Deletion can be requested for bills proposed by inactive parties on the Bill Clearout Requests thread: http://forum.particracy.net/viewtopic.php?f=11&t=4363

Random quote: "Soldiers are not the enemies of the movement. They're potential allies. They're more than that. Soldiers are the only people in America who are paying a stiff price for this war. Everybody else profits. Soldiers are the ones losing their lives, losing friends, having their lives disrupted. The real victims of American imperialism are its soldiers." - Fred Gardner

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51