Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: February 5474
Next month in: 03:19:17
Server time: 20:40:42, April 23, 2024 CET
Currently online (2): Autokrator30 | TaMan443 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


União CNdT [IPFT][?]

This page contains information about the União CNdT [IPFT].

This party is inactive.

Details

User[?]: Tuková Bomba

Nation[?]: República Popular Tukarense (Tukarali)

Seats[?] in Assembleia da República Popular (National Assembly)[?]: 0

Color[?]:

 

Description[?]:

Full name in Portugese: União Conservadora Nacional do Tukaranese
Full name in English: National Conservative Union of Tukarali
--------------------------------------------------------------------------------
*Party is member of IPFT*
(http://classic.particracy.net/vieworganization.php?organizationid=4880)
--------------------------------------------------------------------------------
Chairman: Téo Simões (Candidate for president)
1st Vice-chairman: Germano Simões (Candidate for Minister of Internal Affairs)
2nd Vice-chairman: Elpidio Simões (Candidate for Minister of Defence)
Spokesman: Fred Simões (Candidate for Minister Infrastructure and Transport)
Parliamentary Club Leader: Sandra Simões (Candidate for Minister of Finance)
--------------------------------------------------------------------------------
Founded: April 4358
Members: 14 (from one family)
Ideologies: National Conservatism, Nationalism (unofficialy), Populism (unofficialy), Fascism (unofficialy), National Socialism (unofficialy)
Youth Wing: Young Conservatives
Social position: Extremely Right Wing
Economic Positon: Extremely Left Wing
--------------------------------------------------------------------------------
Abbreviations:
UCNT in Portguese
NCUT in English
--------------------------------------------------------------------------------
NCUT is National Conservative Extremely Right-Winged party in Tukarali. Party was founded in April 4358 but became NCUT in September 4380. Party is specific for very low amount of members - party has only 14 members from 1 of the richest and most influential family in Tukarali. Members of parliament from NCUT are only these 14 people or non-party members which support this party. Party is considered as one of the most brutal parties in the world and many people indicate this party as fascist party. The members of the party says that they are standart party just like any other party only with different ideologies and people. Party supports Christian majority in Tukarali and pursues atheists and non-christian religions in Tukarali. Party has its own paramilitaries and use them for persecuing atheists and non-christian religions.
--------------------------------------------------------------------------------
--------------------------------------------------------------------------------
My former accounts and parties:
1) Tomášek - Deltárská Strana Zelených 🌻 (DSZ) – Deltaria - http://classic.particracy.net/viewparty.php?partyid=31565
2) Tomík38 - Wrnukaék Grná Prta (WGP) 🌼 - Vanuku - http://classic.particracy.net/viewparty.php?partyid=32012
3) Tomášek38 - Parti Pirate d'Aldurie (Pirates) – Alduria - http://classic.particracy.net/viewparty.php?partyid=32468
4) Delta 12 - الاتحاد الأخضر – Kafuristan - http://classic.particracy.net/viewparty.php?partyid=32744
5) Kazulium - National Revolutionary Workers' Front – Kazulia - http://classic.particracy.net/viewparty.php?partyid=33294
6) Francium - Front National des Travailleurs (FNT) – Lourenne - http://classic.particracy.net/viewparty.php?partyid=33111

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunknownclose to noneperfect
Civil Rightsmoderate restrictiveclose to noneperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistclose to noneperfect
Government Responsibilitiesunknownclose to noneperfect
Marketunknownclose to noneperfect
Militaryconvinced militaristlimitedperfect
Moralitymoderate conservativeclose to noneperfect
Religionunknownclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 43599,845,41860,157,55016.37+16.374325516.86+43
February 43635,847,70163,949,7379.14-7.22222558.63-21
February 43674,599,78156,242,0528.18-0.97202557.84-2
February 43715,135,84865,766,2767.81-0.37192557.45-1
January 43745,357,94064,369,2858.32+0.51192557.45+0
May 43755,763,66963,058,5799.14+0.82212558.24+2
May 43798,733,05558,418,40314.95+5.813825514.90+17
May 438318,826,13553,241,66735.36+20.419325536.47+55
May 438717,215,14560,036,50928.67-6.697625529.80-17
May 439117,461,20354,970,80731.76+3.098325532.55+7
May 439518,891,18156,716,01533.31+1.548725534.12+4
May 439922,997,02062,721,18436.67+3.369925538.82+12
May 440324,664,91762,756,82439.30+2.6410425540.78+5
May 440724,656,67263,284,44238.96-0.3410225540.00-2
May 441126,576,19866,296,01240.09+1.1310325540.39+1
May 441514,124,70564,327,65921.96-18.135725522.35-46
May 441917,240,79863,878,51826.99+5.037025527.45+13
April 442123,538,46461,276,10038.41+11.4210125539.61+31
April 442523,223,23361,340,26737.86-0.559825538.43-3
April 442923,356,52157,992,07740.28+2.4210325540.39+5
April 443325,474,77958,954,80543.21+2.9411225543.92+9
April 443726,385,18863,556,61841.51-1.7010525541.18-7
April 444122,614,49955,445,51440.79-0.7310425540.78-1
April 444522,375,08554,822,79840.81+0.0310425540.78+0
April 444914,874,58944,323,00133.56-7.258525533.33-19
April 445321,250,07654,798,61338.78+5.2210125539.61+16
April 445720,223,60558,773,83234.41-4.379025535.29-11
April 446126,199,27066,671,52539.30+4.8910125539.61+11
April 446524,579,27462,901,27239.08-0.2210025539.22-1
April 446924,124,38461,679,86339.11+0.0410025539.22+0
April 447325,007,19665,503,89238.18-0.949825538.43-2
April 447734,242,74163,451,11253.97+15.7914025554.90+42
April 448131,811,86465,164,53248.82-5.1512525549.02-15
April 448522,805,04163,376,76435.98-12.839325536.47-32
April 448926,597,82164,969,50640.94+4.9610625541.57+13
April 449318,467,36662,323,72429.63-11.317625529.80-30
April 449725,908,14766,334,95939.06+9.4310225540.00+26
April 45015,608,88664,352,4448.72-30.34212558.24-81
April 45053,567,45464,388,9205.54-3.18183555.07-3
April 45097,150,42565,697,90610.88+5.343735510.42+19
August 451113,893,80360,521,19822.96+12.078035522.54+43
August 451517,557,70861,470,06228.56+5.6110135528.45+21
August 451915,813,61359,265,73426.68-1.889535526.76-6
March 452225,804,87263,736,37740.49+13.8014435540.56+49
March 452622,179,79059,913,30737.02-3.4713235537.18-12
March 4530628,40264,482,9160.97-36.0533550.85-129

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the União CNdT [IPFT].

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523

BillCreatedVoting startedVoteBill StatusResult
Military reform 2940March 2940September 2940passed
Fire and hot bill 2940March 2940September 2940passed
Life protection act 2940November 2939September 2940passed
Social Reorganization BillMay 2938May 2938passed
Economic Reorganization BillMay 2938May 2938passed
Equality Bill 2937April 2937April 2939defeated
Fair Administration Bill 2937April 2937April 2939defeated
Abortion Bill 2937March 2937October 2937defeated
Call for early elections, March 2937March 2937October 2937defeated
Cabinet Proposal of March 2937March 2937March 2937defeated
Limitation of police powers 2936April 2936September 2936passed
Divorce policy 2936April 2936September 2936passed
Resolution to Recognize the New MonarchNovember 2934May 2938passed
Compulsory pension system bill 2833May 2933September 2933passed
Cabinet Proposal of October 2931October 2931October 2931passed
InfraEminent domain bill 2930March 2930September 2932passed
Civil rights reform 2929April 2929September 2932passed
Cabinet Proposal of April 2929April 2929April 2929passed
Tukarali peace time military reform 2929March 2929March 2929passed
Justice steering reform 2929March 2929March 2929passed

Random fact: Don't vote yes on a cabinet coalition that doesn't give you the power that you deserve.

Random quote: "In all recorded history there has not been one economist who has had to worry about where the next meal would come from." - Peter Drucker

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51