Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5474
Next month in: 03:00:21
Server time: 12:59:38, April 24, 2024 CET
Currently online (3): AethanKal | Ost | ZulanALD | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Freedom and Justice Party[?]

This page contains information about the Freedom and Justice Party.

This party is inactive.

Details

User[?]: Sethamon

Nation[?]: Dolgavas Impērija / Dolgavan Empire (Dolgava)

Seats[?] in Dolgavas impērijas parlaments (Imperial Dolgavan Parliament)[?]: 0

Color[?]:

 

Description[?]:

The Freedom and Justice Party- Dedicated to life, liberty, property, and the defense thereof.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate federalistlimitedperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistclose to noneperfect
Government Responsibilitiesconvinced small governmenthighperfect
Marketmoderate laissez-fairehighperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate progressiveclose to noneperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 225440,01936,798,8260.11+0.1107500.00+0
October 2258300,02736,895,8810.81+0.7047500.53+4
October 22629,989,26640,056,12024.94+24.1318975025.20+185
October 226611,422,21939,859,55328.66+3.7221675028.80+27
October 227014,316,33242,710,46133.52+4.8625575034.00+39
October 227415,334,20242,436,19336.13+2.6227375036.40+18
October 227825,936,36147,527,89954.57+18.4441275054.93+139
October 228227,020,36348,313,25655.93+1.3642375056.40+11
October 228623,650,71942,617,78555.49-0.4341775055.60-6

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Freedom and Justice Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393

BillCreatedVoting startedVoteBill StatusResult
Health-care ReformsAugust 2424August 2424defeated
Education VAugust 2424August 2424defeated
Bringing back morality to DolgariaAugust 2424August 2424defeated
Military part IIAugust 2424August 2424defeated
Military part IAugust 2424August 2424defeated
Yet another religious billAugust 2424August 2424defeated
Abolishment of Military ServiceJuly 2424August 2424passed
Civilized War ActJuly 2424August 2424defeated
Act Against PovertyJune 2424August 2424defeated
Health Care ActJune 2424August 2424defeated
Minimum Education ActJune 2424August 2424passed
Expansion of Organ DonationJune 2424August 2424defeated
Senate Expansion ActJune 2424August 2424defeated
Intelligence Restriction ActJune 2424August 2424defeated
Public Transport ActMarch 2424June 2424defeated
Chemical/Biological Weapons BanMarch 2424June 2424defeated
Eminent Domain ActMarch 2424June 2424defeated
Bill of National RichesJanuary 2424June 2424defeated
Eco BillSeptember 2423October 2423defeated
Religion in the EmpireSeptember 2423September 2423defeated

Random fact: It usually takes up to an hour for election results to generate. During this time, the "Next Election" date is put forward a month, which is confusing. Do not worry! In a short time, the election result will generate and the "Next Election" date will then correct itself.

Random quote: "Difference of religion breeds more quarrels than difference of politics." - Wendell Phillips

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51