Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5471
Next month in: 00:21:11
Server time: 07:38:48, April 19, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Partito Popolare Osiano[?]

This page contains information about the Partito Popolare Osiano.

This party is inactive.

Details

User[?]: Ab3012

Nation[?]: Repubblica Istaliana (Istalia)

Seats[?] in Camera dei Deputati (Chamber of Deputies) [?]: 0

Color[?]:

 

Description[?]:

The Hosian Popular Party is the heir of the party Hosian Democracy that was founded by Ferdinando Rumor (protagonist of the refoundation of Istalia and of the Istalian Empire in 5103) in 5072 and active until 5215 when it was reformed in the current party by Carolina Dominici. HD influenced a lot the first half century of the history of the Third Empire, leading several governments opposing the rightist National Alliance. In the second half of the century the party lost the favor of the centrist and center-leftist electorate in favor of new communist parties and eventually it reformed itself deciding to adopt a more moderate and centrist stance.

Like HD also HPP is a hosian democratic party that views the traditional values of hosianism as the moral foundation of Istalia that our citizens should rediscover against degeneration of society and morality. Unlike HD, HPP, although still supporting a social approach to the economy, distanced itself from the most leftist positions to find a new space and to offer new responses to the citizens placing itself between the far-leftist socialist and communist parties and the extreme liberalism of National Alliance.

Federal Secretary of Hosian Democracy (5072-5215):
Ferdinando Rumor
Egidio Forlanini
Sara Esposito
Dario Barbani
Felice Adinolsi

Federal Secretary of HPP (since 5215):
Carolina Dominici
Giorgia De Magistris

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsmoderate restrictivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate big governmenthighperfect
Marketconvinced regulatormoderateperfect
Militaryconvinced militaristclose to noneperfect
Moralitymoderate conservativemoderateperfect
Religionmoderate religiousmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 458420,908,05260,241,04734.71+34.7123868134.95+238
February 458623,699,38030,118,53778.69+43.9853368178.27+295
April 459022,975,25329,171,09778.76+0.0752868177.53-5
April 459422,641,84528,711,79078.86+0.1053568178.56+7
April 459819,887,45949,889,61239.86-39.0026668139.06-269
April 460222,540,35638,641,52558.33+18.4739568158.00+129
April 460614,582,88132,183,59745.31-13.0230568144.79-90
August 461011,250,06929,494,38638.14-7.1725868137.89-47
August 461413,603,65846,145,86229.48-8.6620268129.66-56
August 461810,555,52551,453,89520.51-8.9714168120.70-61
April 46217,270,41647,603,72115.27-5.249768114.24-44
April 46256,463,86454,408,53011.88-3.397668111.16-21
January 46298,889,55055,823,96515.92+4.0410568115.42+29
April 46319,038,64151,294,88517.62+1.7011568116.89+10
April 46359,338,59151,797,28218.03+0.4112068117.62+5
April 46397,003,77350,867,49213.77-4.268968113.07-31
May 46427,217,34950,304,38414.35+0.589468113.80+5
May 464611,047,24051,927,27421.27+6.9314568121.29+51
May 46504,620,35350,161,9589.21-12.06646819.40-81
May 46549,076,99157,118,65615.89+6.6810868115.86+44
May 46589,446,52241,130,78222.97+7.0815268122.32+44
May 46627,405,06030,728,95324.10+1.1315568122.76+3
May 46664,855,08356,230,3158.63-15.46566818.22-99
May 46709,225,84962,474,52914.77+6.1310068114.68+44
May 46745,981,87338,313,57815.61+0.8510868115.86+8
May 46787,073,77033,194,86521.31+5.7014168120.70+33
February 468010,961,67333,911,71832.32+11.0121468131.42+73
February 468410,814,20551,844,51520.86-11.4714468121.15-70
February 46886,751,22655,441,04412.18-8.688068111.75-64
February 469210,299,18851,973,67119.82+7.6413568119.82+55
February 46964,430,29557,933,9557.65-12.17546817.93-81
February 46997,522,24759,219,96512.70+5.068568112.48+31
February 470311,243,91860,952,78318.45+5.7412368118.06+38
January 470510,214,72157,374,84317.80-0.6412068117.62-3
January 47096,169,39860,073,69810.27-7.53676819.84-53
January 47126,556,45159,751,64510.97+0.707368110.72+6
January 47169,211,33259,436,43515.50+4.5210868115.86+35
January 47203,967,46658,435,1076.79-8.71436816.31-65
January 47247,104,65249,279,60114.42+7.639768114.24+54
February 47277,629,30444,203,92217.26+2.8411468116.74+17
January 47307,619,51447,329,09216.10-1.1611768117.18+3
March 47348,958,58645,707,15019.60+3.5013668119.97+19
April 47348,725,96246,771,43018.66-0.9412968118.94-7
February 47395,838,03146,903,76612.45-6.218168111.89-48
February 474311,221,12846,006,33224.39+11.9416968124.82+88
February 47476,094,14453,382,69111.42-12.977868111.45-91
May 47498,051,89145,216,20117.81+6.3911868117.33+40
May 47538,952,27444,788,04319.99+2.1813368119.53+15
May 475710,664,05545,767,24523.30+3.3115968123.35+26
May 476112,133,80745,430,06326.71+3.4118368126.87+24
May 47659,519,55843,931,26621.67-5.0415268122.32-31
May 47699,127,09150,645,74118.02-3.6512568118.36-27
May 47737,594,84951,664,90614.70-3.3210668115.57-19
May 47778,526,40554,576,80715.62+0.9211168116.30+5
January 47848,616,66030,080,93428.64+13.0218568127.17+74
January 478810,581,39636,495,03428.99+0.3520268129.66+17
January 47921,813,21212,078,05815.01-13.9810468115.27-98
December 47932,649,29312,328,92621.49+6.4814668121.44+42
December 47972,558,60412,214,15820.95-0.5414168120.70-5
January 48004,996,69811,749,91042.53+21.5829368143.02+152
January 48045,402,17311,932,81045.27+2.7531168145.67+18
January 480814,885,10826,613,59855.93+10.6637568155.07+64
January 48129,783,16436,506,06526.80-29.1317568125.70-200
February 481617,675,72135,987,94649.12+22.3232568147.72+150
February 482012,702,78532,548,42639.03-10.0925668137.59-69
February 482416,671,99333,012,36250.50+11.4733768149.49+81
February 48289,311,09932,354,09428.78-21.7220668130.25-131
February 483212,359,44455,529,22322.26-6.5215168122.17-55
February 483611,272,61661,086,31818.45-3.8012468118.21-27
February 484010,821,77854,844,28119.73+1.2814668121.44+22
February 48449,772,99329,108,75233.57+13.8419568128.63+49
February 484820,723,48860,056,21234.51+0.9323468134.36+39
February 485611,589,55435,823,48132.35-2.1521168130.98-23
February 48605,206,55660,917,5738.55-23.80586818.52-153
February 486412,795,70564,029,07519.98+11.4413768120.12+79
December 486510,503,16361,889,97616.97-3.0111468116.74-23
December 48695,512,40462,591,8968.81-8.16586818.52-56
December 48734,206,09062,223,3686.76-2.05466816.75-12
December 48772,945,73763,519,7524.64-2.12336814.85-13
May 48785,509,70061,999,1208.89+4.25626819.10+29
October 488016,990,95760,907,84127.90+19.0119868129.07+136
October 48846,355,14760,476,28710.51-17.397068110.28-128
November 48855,236,28961,927,2518.46-2.05576818.37-13
April 48866,599,78561,807,45110.68+2.227268110.57+15
April 48906,664,36064,233,84910.38-0.307268110.57+0
April 489410,127,42262,450,69916.22+5.8411068116.15+38
April 48987,104,90862,943,57811.29-4.937968111.60-31
July 49053,262,81160,685,4825.38-5.91346814.99-45
July 490918,523,08261,836,26129.96+24.5820868130.54+174
August 49127,848,74863,030,62512.45-17.508668112.63-122
March 49138,694,36458,251,36514.93+2.4710868115.86+22
February 491719,237,92365,823,38929.23+14.3020068129.37+92
February 492112,009,59464,375,15318.66-10.5712868118.80-72
February 49259,320,53057,051,82516.34-2.3211168116.30-17
November 492710,459,42358,689,21217.82+1.4812068117.62+9
January 493012,629,08749,977,51025.27+7.4516968124.82+49
December 493219,777,78350,405,16939.24+13.9726468138.77+95
December 493618,204,62453,269,09534.17-5.0623568134.51-29
December 494016,741,66750,787,84632.96-1.2122868133.48-7
February 5082887,74627,934,9853.18-29.7952002.50-223
February 508612,678,59259,976,52221.14+17.964320021.50+38
February 509014,847,71058,284,54025.47+4.3411445025.33+71
February 509413,176,85557,296,78423.00-2.4810745023.78-7
February 509812,392,04449,354,03125.11+2.1112645028.00+19
February 510215,772,67948,691,81032.39+7.2815445034.22+28
February 510619,187,65825,879,68974.14+41.7532845072.89+174
February 51105,566,20112,001,67146.38-27.7620945046.44-119
February 51144,540,48111,276,45840.27-6.1117945039.78-30
February 51186,026,59611,706,99951.48+11.2123245051.56+53
February 512228,422,94857,524,45149.41-2.0722345049.56-9
February 51266,249,56212,495,93350.01+0.6022445049.78+1
February 51306,184,82111,427,43354.12+4.1124145053.56+17
February 51346,596,62312,111,96854.46+0.3424745054.89+6
February 51386,616,57011,557,81357.25+2.7826145058.00+14
February 51423,448,95212,089,05828.53-28.7212645028.00-135
February 51462,564,86012,282,40620.88-7.659345020.67-33
February 51502,691,79712,000,76222.43+1.5510645023.56+13
February 51543,615,18211,852,79930.50+8.0713745030.44+31
December 51565,457,97911,796,39146.27+15.7720445045.33+67
December 51606,282,78211,729,50253.56+7.3024345054.00+39
December 51645,522,87311,667,50847.34-6.2321645048.00-27
December 51685,073,18411,795,38243.01-4.3319445043.11-22
December 51727,978,22431,434,35025.38-17.6312245027.11-72
December 51762,686,29511,693,15422.97-2.4110145022.44-21
December 51808,720,16237,307,79523.37+0.409545021.11-6
April 51832,152,57611,364,02918.94-4.438545018.89-10
March 51853,821,52812,274,53631.13+12.1913845030.67+53
March 518911,197,93757,443,80419.49-11.648545018.89-53
March 519311,144,07037,455,98129.75+10.2613845030.67+53
March 519711,814,02740,408,46229.24-0.5214045031.11+2
March 52018,244,04038,117,34021.63-7.6110345022.89-37
March 52058,963,43637,964,24723.61+1.9810745023.78+4
March 52096,528,93636,140,37518.07-5.548145018.00-26
March 52133,565,16832,653,21810.92-7.155045011.11-31
March 521710,172,25136,048,36528.22+17.3012445027.56+74
March 52213,292,97411,900,33827.67-0.5511745026.00-7
March 52259,425,01458,712,45616.05-11.627145015.78-46
March 52295,455,48638,475,91614.18-1.876545014.44-6
March 52339,164,83736,131,24425.37+11.1911345025.11+48
March 52379,081,30937,685,45924.10-1.2711045024.44-3
March 524113,900,24637,042,52137.53+13.4317045037.78+60
March 52455,617,57431,625,14817.76-19.767645016.89-94
March 524912,699,99144,735,12028.39+10.6312345027.33+47
September 525013,580,93047,551,40528.56+0.1712345027.33+0
September 52549,547,02847,317,25920.18-8.388845019.56-35
September 52588,590,79033,174,87325.90+5.7211645025.78+28
September 52627,611,81729,802,95925.54-0.3511445025.33-2
September 52667,679,80030,962,21324.80-0.7411345025.11-1
July 527014,001,72933,519,42841.77+16.9719045042.22+77
July 527411,445,08834,046,41933.62-8.1615045033.33-40
July 527818,074,22351,653,05234.99+1.3814945033.11-1
July 52829,127,29435,147,55325.97-9.0211445025.33-35
September 52859,691,66359,705,76916.23-9.747345016.22-41
September 52897,843,76148,889,45616.04-0.198245018.22+9

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Partito Popolare Osiano.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839

BillCreatedVoting startedVoteBill StatusResult
P.d.l. 02/4370: Protecting Endangered AnimalsMarch 4370May 4370defeated
P.d.l. 03/4370 - Stop pampering illegal aliensMarch 4370March 4370defeated
P.d.l. 01/4370: TOC RegulationFebruary 4370May 4370defeated
Income tax proposal of February 4370February 4370May 4370defeated
P.d.l. 9/4370: The Restoration of Democratic ValuesDecember 4369December 4370defeated
P.d.l. 12/4369 - Loop to industrial pollutionDecember 4369December 4369passed
P.d.l. 11/4369 - Cultural development in IstaliaOctober 4369April 4371defeated
P.d.l 12/4369: Establishment of a Salary for ParliamentariansOctober 4369February 4370passed
Ratification of the Condemnation of the Orderist Terrorism in Western MajatraOctober 4369February 4370passed
D.d.l. 03/4369 - Subsidies to industrial operationsOctober 4369December 4369passed
P.d.l. 11/4369 - Making sports accessible for everyoneOctober 4369October 4369defeated
P.d.l. 10/4369 - Ethics in Ecological LegislationOctober 4369October 4369defeated
D.d.l. 04/4369 - Budget Spending ProposalJune 4369March 4371passed
D.d.l. 01/4369 - Income Tax ProposalJune 4369June 4369passed
P.d.l. 07/4369: Defense of National CompaniesApril 4369May 4369passed
P.d.l. 09/4369 - An Istalia worth fighting for [Part 2]April 4369April 4369defeated
P.d.l. 08/4369 - An Istalia worth fighting for [Part 1]April 4369April 4369defeated
Ratification of the Extradition Terms TreatyApril 4369April 4369defeated
P.d.l. 01/4369 - Istalian Education ReformMarch 4369April 4371defeated
D.d.l. 02//4369 - Eminent Domain and Full subsidies to public transport forma low-income familiesMarch 4369September 4369passed

Random fact: Real-life quotations may be used in Particracy, but the real-life speaker or author should always be referenced in an OOC (out-of-character) note alongside the quotation.

Random quote: "Any law which violates the inalienable rights of man is essentially unjust and tyrannical; it is not a law at all." - Maximilien Robespierre

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51