Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: February 5461
Next month in: 01:37:24
Server time: 22:22:35, March 28, 2024 CET
Currently online (5): dnobb | Maarten_saridan | reformist2024 | rezins | Svet-Aldegar | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Liberal-Monarchists of Vorona[?]

This page contains information about the Liberal-Monarchists of Vorona.

This party is inactive.

Details

User[?]: Rex_9

Nation[?]: State of Vorona (Vorona)

Seats[?] in National Assembly[?]: 0

Color[?]:

 

Description[?]:

Founded in October 4704, the Liberal-Monarchists of Vorona (LMV) are a party that espouses classical liberal ideas and support for a Voronan monarchy.

LMV is led by Alfred Wheaton, and has the support of Raymond Bavoria, the pretender to the Voronan throne.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketregulator-leaningexcellentperfect
Militaryfanatical militaristlimitedperfect
Moralitymoderate progressivemoderateperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 47066,17124,890,7370.02+0.0202000.00+0
March 47107,263,55225,181,25728.85+28.825820029.00+58

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Liberal-Monarchists of Vorona.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325

BillCreatedVoting startedVoteBill StatusResult
Cabinet Proposal of May 5280May 5280May 5280passed
Call for early elections, April 5280April 5280April 5280defeated
Cabinet Proposal of September 5279September 5279September 5279defeated
Luxury Sales Tax IncreaseAugust 5270August 5270passed
Call for early elections, April 5269April 5269April 5269defeated
Luxury Sales Tax IncreaseFebruary 5262April 5269defeated
Parliamentary Term Adjustment AmendmentFebruary 5262April 5269passed
National Sport ActAugust 5258September 5260passed
Ratification of the Beiteynu Accord of PartnershipFebruary 5253August 5253passed
Ratification of the Beiteynu Accord of TradeFebruary 5253August 5253passed
National Motto ActFebruary 5253August 5253passed
Public Transport Adjustment ActFebruary 5250August 5251passed
Act to Change the Title of the Head of GovernmentFebruary 5250August 5251passed
Eminent Domain ActFebruary 5246February 5246passed
Acts on Public Sexual PerformanceFebruary 5246February 5246passed
Conceal Weapons Permit ActAugust 5243August 5244passed
Hunting Regulation ActAugust 5243August 5244passed
Artistic Media Freedom for Movies ActJuly 5242July 5242passed
Abolishing Charter Schools ActJuly 5242July 5242passed
Cabinet Proposal of March 5241March 5241March 5241passed

Random fact: Moderation will not accept Cultural Protocol updates which introduce, on a significant scale, cultures which are likely to be insufficiently accessible to players. In particular, for all significant cultures in Particracy, it should be easy for players to access and use online resources to assist with language translation and the generation of character names. Moderation reserves the right to amend Cultural Protocols which are deemed to have introduced significant cultures that are not sufficiently accessible and which are not being actively role-played with.

Random quote: "War crimes is such a lilliputian term for the atrocities committed by the Yeudish state." - Katrine Lorenzen, former Kazulian diplomat

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52