Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5472
Next month in: 02:36:35
Server time: 17:23:24, April 20, 2024 CET
Currently online (8): Arusu-Weareback | Bureaucrat | Caoimhean | DanivonX | hyraemous | itsjustgav | JourneyKun | LC73DunMHP | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Deltarian Komitet Gosundarstvennoy Bezop[?]

This page contains information about the Deltarian Komitet Gosundarstvennoy Bezop.

This party is inactive.

Details

User[?]: California Stars

Nation[?]: Jamahiriat al-Qalb (Kafuristan)

Seats[?] in Majlis-al-Umma (National Assembly)[?]: 0

Color[?]:

 

Description[?]:

The Moderate Social Democratic Party, is a pan-Kafuristani party seeking a moderate path towards enlightenment.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristlimitedperfect
Civil Rightsmoderate permissivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate small governmentlimitedperfect
Marketregulator-leaninglimitedperfect
Militaryconvinced pacifistlimitedperfect
Moralityconservative-leaninglimitedperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 230716,937,89058,438,12328.98+28.9815151229.49+151
January 230812,545,73949,890,17425.15-3.8413651226.56-15
October 230911,955,96148,841,51624.48-0.672610026.00-110
February 231011,739,67647,455,64524.74+0.262610026.00+0
April 23144,971,31860,514,1418.22-16.5281008.00-18
April 23203,402,76263,491,5945.36-2.8641004.00-4
September 23207,051,52463,338,33711.13+5.771010010.00+6
October 23433,183,70665,488,5124.86-6.27184004.50+8
March 23474,504,06859,874,2047.52+2.66304007.50+12
August 23507,629,19661,616,42212.38+4.864640011.50+16

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Deltarian Komitet Gosundarstvennoy Bezop.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378

BillCreatedVoting startedVoteBill StatusResult
KSP BIllSeptember 2428September 2428defeated
KSP Justice BillSeptember 2428September 2428defeated
KSP Agriculture BillSeptember 2428September 2428defeated
KSP Administration BillSeptember 2428September 2428defeated
Income tax proposal of June 2428June 2428June 2428passed
Budget proposal of June 2428June 2428June 2428passed
Cabinet Proposal of June 2428June 2428June 2428passed
Adult DecisionsApril 2428March 2429defeated
Abolishment of Price SubsidesApril 2428June 2428passed
Denationalization of Electrical FacilitiesApril 2428June 2428passed
Tax Reduction ActApril 2428June 2428passed
Income tax proposal of October 2427October 2427October 2427passed
Budget proposal of October 2427October 2427October 2427passed
Call for early elections, September 2427September 2427September 2427defeated
Needless Extraterrestrial RegulationSeptember 2427September 2427defeated
KSP Religion BillSeptember 2427September 2427defeated
The "Kafuris....In....Space!" Reimplamentation ActAugust 2427August 2427passed
Head of Government ActAugust 2427August 2427defeated
Eminent Domain Reform ActJuly 2427July 2427passed
Postal Service Regulations ActJuly 2427July 2427passed

Random fact: When you join the game, you will find yourself with only zero seats. That's because your party's representatives haven't been elected yet. You need to establish your party's position on issues by proposing several bills that your party wants passed and sending them to vote. This raises your visibility and if you do it enough, you will win seats at the next election.

Random quote: "Politics have no relation to morals." - Niccolo Machiavelli

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51