Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: January 5475
Next month in: 03:53:09
Server time: 16:06:50, April 25, 2024 CET
Currently online (1): Ost | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Deltarian Komitet Gosundarstvennoy Bezop[?]

This page contains information about the Deltarian Komitet Gosundarstvennoy Bezop.

This party is inactive.

Details

User[?]: California Stars

Nation[?]: Jamahiriat al-Qalb (Kafuristan)

Seats[?] in Majlis-al-Umma (National Assembly)[?]: 0

Color[?]:

 

Description[?]:

The Moderate Social Democratic Party, is a pan-Kafuristani party seeking a moderate path towards enlightenment.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristlimitedperfect
Civil Rightsmoderate permissivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate small governmentlimitedperfect
Marketregulator-leaninglimitedperfect
Militaryconvinced pacifistlimitedperfect
Moralityconservative-leaninglimitedperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
May 230716,937,89058,438,12328.98+28.9815151229.49+151
January 230812,545,73949,890,17425.15-3.8413651226.56-15
October 230911,955,96148,841,51624.48-0.672610026.00-110
February 231011,739,67647,455,64524.74+0.262610026.00+0
April 23144,971,31860,514,1418.22-16.5281008.00-18
April 23203,402,76263,491,5945.36-2.8641004.00-4
September 23207,051,52463,338,33711.13+5.771010010.00+6
October 23433,183,70665,488,5124.86-6.27184004.50+8
March 23474,504,06859,874,2047.52+2.66304007.50+12
August 23507,629,19661,616,42212.38+4.864640011.50+16

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Deltarian Komitet Gosundarstvennoy Bezop.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378

BillCreatedVoting startedVoteBill StatusResult
HAA 15, Tax Reduction BillMarch 5212July 5212passed
HAA 14, Income Tax Proposal of March 5212March 5212July 5212passed
HAA 13, Budget Proposal of 5212March 5212July 5212passed
HAA 12, Withdrawal from OrganizationSeptember 5211April 5212passed
HAA 11, Withdrawal from AgreementSeptember 5211April 5212passed
Ratification of the Agreement on the Trans-Majatran Corridors NetworkJuly 5211July 5212defeated
AmendmentsJune 5211June 5211passed
Ratification of the Accord of Tactical IntelligenceApril 5211July 5212defeated
HAA 10,April 5211April 5211passed
HAA 9, Eminent Domain ActOctober 5210April 5211passed
HAA 8, Operating AmendmentsFebruary 5210October 5210passed
New AmendmentsJuly 5209July 5209passed
HAA 7, Adjustment ActApril 5209February 5210passed
AmendmentsJanuary 5209January 5209defeated
Cabinet Proposal of October 5208October 5208October 5208passed
Ratification of the Beiteynu Accord of DiplomacyJuly 5208September 5208passed
Cabinet Proposal of July 5208July 5208July 5208passed
New amendmentsJune 5208June 5208passed
Call for early elections, March 5208March 5208March 5208passed
HAA 5, Religious Regulation Adjustment ActAugust 5207October 5208passed

Random fact: When your party holds the foreign affairs department, you can create new treaties. However, before writing anything new, it is a good idea to search for existing treaties which already accomplish what you desire.

Random quote: "I never dared to be radical when young. For fear it would make me conservative when old." - Robert Frost

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51