Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5248
Next month in: 01:43:19
Server time: 14:16:40, January 28, 2023 CET
Currently online (2): HawkIstalia | Xandre | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Worker's Party of Vorona - Tedjist[?]

This page contains information about the Worker's Party of Vorona - Tedjist.

This party is inactive.

Details

User[?]: flimpflampflomp

Nation[?]: Koperasi Republik Vorona/Cooperative Republic of Vorona (Vorona)

Seats[?] in National Assembly[?]: 0

Color[?]:

 

Description[?]:

The party for all Voronese workers. Tedjist (Titoist) faction of the WPV, led by Susanto Tedjo.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationconvinced unitaristlimitedperfect
Civil Rightsconvinced restrictivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced isolationistclose to noneperfect
Government Responsibilitiesconvinced big governmentclose to noneperfect
Marketextreme regulatorlimitedperfect
Militarymoderate militaristlimitedperfect
Moralityconvinced conservativelimitedperfect
Religionunknownclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 49651,669,8224,848,87034.44+34.4413840034.50+138
December 49652,291,1314,563,01350.21+15.7720140050.25+63
March 49667,361,3629,719,42275.74+25.5330440076.00+103
March 49725,421,31212,237,78544.30-31.4433375044.40+29
March 497411,578,23616,376,67370.70+26.4052975070.53+196
March 49768,884,97314,571,36060.98-9.7245975061.20-70
March 49788,706,31714,200,87161.31+0.3346075061.33+1
March 49808,455,42314,550,53958.11-3.2043775058.27-23
March 49827,942,67114,132,39256.20-1.9142375056.40-14
March 49848,371,85413,554,12761.77+5.5645975061.20+36
March 49867,737,72013,314,35958.12-3.6543375057.73-26
March 49884,665,4514,681,48699.66+41.5474875099.73+315
March 499014,513,76717,910,43981.04-18.6259475079.20-154
March 499217,108,22722,802,63675.03-6.0153975071.87-55
March 499417,444,72123,217,68075.14+0.1154075072.00+1
March 499617,045,70122,655,51375.24+0.1053875071.73-2
March 499821,612,34525,223,59085.68+10.4463975085.20+101
March 500024,284,77925,067,28696.88+11.2072875097.07+89
March 500217,785,53223,515,99175.63-21.2556375075.07-165

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Worker's Party of Vorona - Tedjist.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319

BillCreatedVoting startedVoteBill StatusResult
Eminent Domain ActFebruary 5246February 5246passed
Acts on Public Sexual PerformanceFebruary 5246February 5246passed
Conceal Weapons Permit ActAugust 5243August 5244passed
Hunting Regulation ActAugust 5243August 5244passed
Artistic Media Freedom for Movies ActJuly 5242July 5242passed
Abolishing Charter Schools ActJuly 5242July 5242passed
Cabinet Proposal of March 5241March 5241March 5241passed
Abolishing CopyrightsFebruary 5241March 5241passed
Regulation of Drug Sales ActFebruary 5239February 5239passed
Drug Reform ActFebruary 5239February 5239passed
Ratification of the International Union for Conservation of Nature (IUCN)August 5236August 5236passed
Ratification of the International Agreement on Nuclear Non-Proliferation (IANN)August 5236August 5236passed
Ratification of the Treaty on the Rights of Indigenous Peoples (TRIP)August 5236August 5236passed
Ratification of the Treaty for the Protection of Endangered AnimalsAugust 5236August 5236passed
Ratification of the Treaty on the Keeping of Endangered AnimalsAugust 5236August 5236passed
Fairness ActAugust 5236August 5236passed
Seat Readjustment ActAugust 5236August 5236passed
Corporation Tax IncreaseAugust 5236August 5236passed
Ratification of the Terran Wide WebSeptember 5235September 5235passed
Taxation Adjustment on Non-essential Goods/ServicesSeptember 5235September 5235passed

Random fact: Particracy is completely free! If you want to support the game financially, feel free to make a small donation to the lievenswouter@gmail.com Paypal account.

Random quote: "I like to pay taxes. With them I buy civilization." - Oliver Wendell Holmes, Jr.

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51