Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5471
Next month in: 02:29:59
Server time: 13:30:00, April 18, 2024 CET
Currently online (2): Interstellar. | Mbites2 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Worker's Party of Vorona - Tedjist[?]

This page contains information about the Worker's Party of Vorona - Tedjist.

This party is inactive.

Details

User[?]: flimpflampflomp

Nation[?]: Vorona (Vorona)

Seats[?] in Royal Assembly[?]: 0

Color[?]:

 

Description[?]:

The party for all Voronese workers. Tedjist (Titoist) faction of the WPV, led by Susanto Tedjo.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationconvinced unitaristlimitedperfect
Civil Rightsconvinced restrictivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced isolationistclose to noneperfect
Government Responsibilitiesconvinced big governmentclose to noneperfect
Marketextreme regulatorlimitedperfect
Militarymoderate militaristlimitedperfect
Moralityconvinced conservativelimitedperfect
Religionunknownclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 49651,669,8224,848,87034.44+34.4413840034.50+138
December 49652,291,1314,563,01350.21+15.7720140050.25+63
March 49667,361,3629,719,42275.74+25.5330440076.00+103
March 49725,421,31212,237,78544.30-31.4433375044.40+29
March 497411,578,23616,376,67370.70+26.4052975070.53+196
March 49768,884,97314,571,36060.98-9.7245975061.20-70
March 49788,706,31714,200,87161.31+0.3346075061.33+1
March 49808,455,42314,550,53958.11-3.2043775058.27-23
March 49827,942,67114,132,39256.20-1.9142375056.40-14
March 49848,371,85413,554,12761.77+5.5645975061.20+36
March 49867,737,72013,314,35958.12-3.6543375057.73-26
March 49884,665,4514,681,48699.66+41.5474875099.73+315
March 499014,513,76717,910,43981.04-18.6259475079.20-154
March 499217,108,22722,802,63675.03-6.0153975071.87-55
March 499417,444,72123,217,68075.14+0.1154075072.00+1
March 499617,045,70122,655,51375.24+0.1053875071.73-2
March 499821,612,34525,223,59085.68+10.4463975085.20+101
March 500024,284,77925,067,28696.88+11.2072875097.07+89
March 500217,785,53223,515,99175.63-21.2556375075.07-165

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Worker's Party of Vorona - Tedjist.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326

BillCreatedVoting startedVoteBill StatusResult
The total number of seats in the legislative assemblyAugust 3385August 3385defeated
Humane Abortion Act of 3385July 3385January 3386passed
The right for a person to prostitute himself or herself..April 3385April 3385passed
The government's policy concerning diplomatic immunity.April 3385April 3385passed
Cabinet Proposal of April 3385April 3385April 3385passed
Military Reform Act 3385April 3385April 3385passed
Eminent Domain.August 3383August 3383passed
The Legality of DuelingMay 3382May 3382passed
.May 3382May 3382passed
The government's policy on public nudityMay 3382May 3382passed
.April 3382May 3382passed
Weapon concealment ( Act )April 3382April 3382defeated
Cabinet Proposal of April 3382April 3382April 3382passed
The Government's policy regarding bestiality ( Act )April 3382April 3382passed
The Government�s policy with respect to adulteryApril 3382April 3382passed
Trade Union Strike Ballots ( Act )February 3378February 3378defeated
The recreational drug policy ( Act )August 3377August 3377passed
Cabinet Proposal of April 3376April 3376April 3376passed
Military ReformSeptember 3375May 3376passed
The government's policy concerning private cars ( Act )March 3375March 3375defeated

Random fact: Moderation will not approve a Cultural Protocol request within the first 48 hours of it being requested. This is in order to give other players a chance to query the proposed changes, if they wish to do so. Moderation may be approached for advice on a proposed change, but any advice proffered should always be understood under the provisio that no final decision will be made until at least 48 hours after the request has been formally submitted for approval.

Random quote: "The true revolutionary is guided by great feelings of love. It is impossible to think of a genuine revolutionary lacking this quality." - Che Guevara

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51