Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: January 5475
Next month in: 02:50:10
Server time: 17:09:49, April 25, 2024 CET
Currently online (3): ADM Drax | burgerboys | itsjustgav | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


National Strength Party[?]

This page contains information about the National Strength Party.

This party is inactive.

Details

User[?]: GregWilford

Nation[?]: Harmadik Ndráloni Direktoriális Köztársaság (Endralon)

Seats[?] in Legislative Senate[?]: 0

Color[?]:

 

Description[?]:

An ultra-right wing party, believes in strong government, strong leader (monarchy if possible) and tough foreign relations.
current leader Captain Edward Norton comes from a traditionally aristocratic family and would happily rule our nation. Edward Norton was exiled from his homeland of Keymon after alligations of piracy. The good captain maintains that he was always a privateer rather, working for the crown. He sailed his ship, "The Southern Sloop" from Keymon, but bad weather brought him to the Republic of Endralon. He applied for citizenship and used his wealth (plunder) to establish the National Strength Party.

In the March 2455 the National Strength Party won 149 seats, assuming the role of largest party in Parliament. In this term the Party began to look at its long term aims which included the possibility of restoring a monarchy.

July 2487- Captain Edward Norton dies suddenly, his deputy, Rudolph Schwartz assumes leadership.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsconvinced restrictivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningmoderateperfect
Government Responsibilitiesconvinced small governmentmoderateperfect
Marketmoderate laissez-fairemoderateperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate conservativemoderateperfect
Religionmoderate religiouslimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 245031,03189,159,7870.03+0.0305000.00+0
September 245212,574,26389,463,54314.06+14.027050014.00+70
March 245524,843,58684,488,46929.40+15.3514950029.80+79
September 245717,482,48785,521,39020.44-8.9610350020.60-46
July 245914,317,68290,989,58815.74-4.717850015.60-25
December 246013,473,95088,455,28715.23-0.507750015.40-1
June 246314,229,32292,924,83315.31+0.087650015.20-1
December 246512,556,29392,556,58913.57-1.756950013.80-7
June 246811,022,82589,036,90712.38-1.196150012.20-8
December 247012,628,37092,414,36113.66+1.286850013.60+7
June 247311,501,84894,684,73812.15-1.526050012.00-8
December 247510,365,38993,082,18811.14-1.015550011.00-5
June 247810,784,53092,482,95311.66+0.535950011.80+4
December 24809,938,69394,632,54810.50-1.165350010.60-6
June 248312,352,83196,528,96212.80+2.296450012.80+11
December 248514,964,96197,367,60415.37+2.577850015.60+14
June 248811,220,17299,903,65211.23-4.145650011.20-22
December 249012,914,32799,750,23912.95+1.726450012.80+8
April 249115,420,45099,083,80115.56+2.627950015.80+15
October 249313,802,160102,345,90213.49-2.086750013.40-12
April 249614,195,51599,611,03314.25+0.777150014.20+4
October 249813,398,32499,282,88113.50-0.766850013.60-3
April 250110,608,694101,778,57010.42-3.075250010.40-16
October 250310,938,574101,541,69610.77+0.355450010.80+2
April 250610,688,739103,232,55810.35-0.425150010.20-3
October 250815,067,909105,948,57014.22+3.877050014.00+19
April 251115,988,451107,081,80714.93+0.717650015.20+6
October 251314,369,491107,254,72013.40-1.536750013.40-9
July 251515,778,963105,171,80315.00+1.617550015.00+8

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the National Strength Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505

BillCreatedVoting startedVoteBill StatusResult
Local Marriage Laws ActJuly 2422July 2422defeated
Cabinet Proposal of June 2422June 2422June 2422defeated
Local Sports Clubs ActMay 2422May 2422passed
Local Eminent Domain ActMay 2422May 2422passed
Local Museums ActMarch 2422March 2422defeated
Local Libraries ActMarch 2422March 2422defeated
Education Reform ActMarch 2422March 2422defeated
Pro-Life ActFebruary 2422February 2422defeated
No National Regulation ActFebruary 2422February 2422defeated
Income tax proposal of February 2422February 2422February 2422passed
animals in medical researchJanuary 2422January 2422defeated
Ratification of the Terran Alliance TreatyDecember 2421December 2421defeated
New Motto (Suggestions wanted!)November 2421August 2422defeated
Income tax proposal of October 2421October 2421May 2422defeated
Pro-God ActSeptember 2421September 2421defeated
No Tariffs ActSeptember 2421September 2421passed
Moderate Cabinet Proposal of September 2421September 2421September 2421passed
Cabinet Proposal of August 2421August 2421August 2421defeated
Anti-Civil War ActAugust 2421August 2421defeated
Change of the constitutionJune 2421September 2422defeated

Random fact: Alduria, Rildanor and Lourenne all have Canrilaise (French) cultures.

Random quote: "If we were to wake up some morning and find that everyone was the same race, creed and color, we would find some other causes for prejudice by noon." - George Aiken

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51