Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5461
Next month in: 03:59:58
Server time: 08:00:01, March 29, 2024 CET
Currently online (1): Brazil25 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Parti de Garde Royales[?]

This page contains information about the Parti de Garde Royales.

This party is inactive.

Details

User[?]: Summersdale

Nation[?]: Royaume Uni de Lourenne (Lourenne)

Seats[?] in Assembleé Royale (Royal Assembly)[?]: 0

Color[?]:

 

Description[?]:

A socio-economic responsible party.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristlimitedperfect
Civil Rightsconvinced restrictivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistlimitedperfect
Government Responsibilitiesmoderate big governmentmoderateperfect
Marketmoderate regulatorlimitedperfect
Militarypacifist-leaninglimitedperfect
Moralitymoderate conservativemoderateperfect
Religionreligious-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 246634,08544,248,8030.08+0.0801000.00+0
December 24702,736,50138,839,8377.05+6.9761006.00+6
December 24735,628,47042,699,16613.18+6.141310013.00+7
December 24765,876,89342,909,61713.70+0.511410014.00+1
December 24797,331,39042,001,24017.46+3.761810018.00+4
October 248112,896,03238,689,03833.33+15.886720033.50+49
October 24849,973,48541,056,57524.29-9.044920024.50-18
October 24875,613,42340,669,37013.80-10.492820014.00-21
April 24885,793,83840,036,98214.47+0.672920014.50+1
April 24914,272,44040,189,13410.63-3.842120010.50-8
April 24945,939,26540,447,26814.68+4.053020015.00+9
November 24964,144,91837,942,71810.92-3.762120010.50-9
February 24983,259,93738,397,9658.49-2.43162008.00-5
February 25015,640,17143,649,25212.92+4.432620013.00+10
February 25043,730,32843,446,0818.59-4.34152007.50-11
February 25075,625,37542,059,60513.37+4.792720013.50+12
February 25105,752,30244,062,72313.05-0.324030313.20+13
February 25135,425,89043,689,04712.42-0.643730312.21-3
February 25165,421,29945,445,97911.93-0.493630311.88-1
February 25197,141,96747,581,06915.01+3.084530314.85+9
February 25227,165,78544,514,84116.10+1.095030316.50+5
February 25256,754,15743,804,80815.42-0.684830315.84-2
February 25286,860,20146,279,67114.82-0.604630315.18-2
February 25316,996,48645,970,08215.22+0.404730315.51+1
February 25347,499,94847,866,38515.67+0.454830315.84+1
March 25367,980,75152,351,51615.24-0.424730315.51-1
March 25397,335,77746,596,96615.74+0.505030316.50+3
January 254212,980,91446,466,98427.94+12.198530328.05+35
January 254511,492,83046,453,09724.74-3.207730325.41-8
January 254810,804,30653,147,81820.33-4.416330320.79-14
January 255110,234,42653,779,23119.03-1.305730318.81-6
December 255311,715,09253,584,60821.86+2.836730322.11+10
March 255612,188,13850,948,14523.92+2.067330324.09+6
April 255715,565,21451,484,59730.23+6.319330330.69+20
April 256012,416,75155,452,56722.39-7.846930322.77-24
April 256311,153,41060,505,03818.43-3.965630318.48-13
April 256612,457,55559,800,37720.83+2.406229920.74+6
April 256912,236,95751,875,74723.59+2.767029923.41+8
April 257220,749,52555,203,42837.59+14.0011129937.12+41
June 257524,727,57160,531,13640.85+3.2612329941.14+12
June 257823,357,96659,784,20439.07-1.7811729939.13-6
June 258119,774,41958,612,14433.74-5.3310129933.78-16
June 258417,434,27157,113,66430.53-3.219129930.43-10
June 258713,865,05955,879,60624.81-5.717529925.08-16
June 259013,650,40454,552,31725.02+0.217729925.75+2
June 259312,695,22956,711,90722.39-2.646929923.08-8
June 259611,648,65457,595,94620.22-2.166329921.07-6
June 259910,590,42456,298,83318.81-1.415729919.06-6
June 260210,732,71252,723,95220.36+1.556229920.74+5
June 260512,084,21060,206,40120.07-0.296129920.40-1
June 260812,906,59764,642,86719.97-0.116029920.07-1
June 261115,438,92765,789,99323.47+3.507129923.75+11
June 261415,345,23866,304,35923.14-0.327129923.75+0
June 261713,166,95460,184,99721.88-1.276729922.41-4
June 262013,398,96958,835,55222.77+0.906829922.74+1
June 262312,386,46755,252,07322.42-0.366729922.41-1
June 262610,869,89154,190,70520.06-2.365929919.73-8
June 262914,399,15067,688,02021.27+1.216429921.40+5
July 263015,601,01063,979,27924.38+3.117429924.75+10
July 263316,359,35867,653,35724.18-0.207129923.75-3
July 263613,154,58764,700,21320.33-3.856329921.07-8
July 263912,274,89571,854,83417.08-3.255129917.06-12
July 264211,494,35364,267,45417.89+0.805429918.06+3
July 26459,213,79465,689,26714.03-3.864029913.38-14
June 264912,406,17275,354,32416.46+2.444829916.05+8
June 265213,421,26370,746,50018.97+2.515729919.06+9
June 265514,486,14863,764,29222.72+3.756829922.74+11
June 265821,387,78763,769,88033.54+10.8210329934.45+35
June 266128,060,18163,843,53443.95+10.4113529945.15+32
October 266223,279,98357,185,68540.71-3.2412529941.81-10
October 266523,805,95557,585,27841.34+0.6312729942.47+2
October 266823,679,86058,533,37240.46-0.8912329941.14-4
October 268731,731,32380,931,12439.21-1.2517745039.33+54
October 269033,387,13981,714,92940.86+1.6518245040.44+5
October 269323,512,94161,817,15238.04-2.8216945037.56-13
April 269623,725,31460,745,95839.06+1.0217445038.67+5
April 269927,658,84965,230,62242.40+3.3518745041.56+13
October 270032,014,84365,427,40948.93+6.5321745048.22+30
October 270320,775,62259,366,40135.00-13.9416445036.44-53
January 270432,744,09280,301,37540.78+5.7818445040.89+20
October 270431,437,59878,493,86340.05-0.7318245040.44-2
October 27078,237,31816,588,56149.66+9.6122145049.11+39
June 27108,043,69116,241,31049.53-0.1322245049.33+1
June 27139,372,10515,891,21258.98+9.4526645059.11+44
June 27169,545,80516,180,88358.99+0.0226245058.22-4
June 271910,689,09817,357,76861.58+2.5927145060.22+9
June 272211,157,04817,335,64464.36+2.7828545063.33+14
November 27249,566,71417,212,29655.58-8.7824745054.89-38
November 27277,530,89816,850,20444.69-10.8920045044.44-47
November 27309,457,78517,120,12355.24+10.5524645054.67+46
November 27338,602,34225,196,54634.14-21.1015345034.00-93

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Parti de Garde Royales.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320

BillCreatedVoting startedVoteBill StatusResult
Adoption Act, 3587May 3587May 3587passed
Use of Nuclear Weaponry in Warfare Act, 3587May 3587May 3587passed
Adultery Act, 3587May 3587May 3587passed
Private Cars Act, 3587May 3587May 3587passed
Treatment of Prisoners of War Act, 3587May 3587May 3587passed
Desecration of the National Flag Act, 3587May 3587May 3587passed
Eminent Domain Compensation Act, 3587May 3587May 3587passed
Powers of Police Act, 3587May 3587May 3587passed
Tort Reform on Non-Civil Lawsuits Act, 3587May 3587May 3587passed
Forensic DNA Database Act, 3587May 3587May 3587passed
Racial Segregation in Educational Institutions Act, 3587May 3587May 3587passed
Cabinet Proposal of September 3586September 3586September 3586passed
The Abortion Act, 3586September 3586September 3586passed
Granting Nationality Act, 3586September 3586September 3586passed
Licensing of Food Sales Act, 3586September 3586September 3586passed
National Refugee Act, 3586September 3586September 3586passed
The Right to Kill Animals Act, 3586September 3586September 3586passed
Funding for Private Schools Act, 3586September 3586September 3586passed
Keeping of Endangered Animals Act, 3586September 3586September 3586passed
Source Code of Software Act, 3586August 3586September 3586passed

Random fact: Never use the same password as a friend. If two or more active accounts use the same password, they will be inactivated.

Random quote: "I do not believe in the creed professed by the Jewish church, by the Roman church, by the Greek church, by the Turkish church, by the Protestant church, nor by any church that I know of. My own mind is my own church." - Thomas Paine

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51