Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: June 5461
Next month in: 00:13:28
Server time: 15:46:31, March 29, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Truth Party[?]

This page contains information about the Truth Party.

This party is inactive.

Details

User[?]: Cruisey

Nation[?]: Dolgavas Impērija / Dolgavan Empire (Dolgava)

Seats[?] in Dolgavas impērijas parlaments (Imperial Dolgavan Parliament)[?]: 0

Color[?]:

 

Description[?]:

Traditionally the doctrine of separation of powers has prevented those who know the law from taking part in its creation. Because of this, career politicians who know nothing have taken control of the legislative process, passing inane laws and expecting the Courts to apply them.
The Truth Party seeks to change this. It is made up of former members of the Judiciary who want to see this nation have a sensible system of laws.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaninglimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate small governmentlimitedperfect
Marketregulator-leaninglimitedperfect
Militarypacifist-leaninglimitedperfect
Moralityconservative-leaninglimitedperfect
Religionmoderate secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 250452,24699,978,5810.05+0.0505550.00+0
December 25069,934,222100,203,9109.91+9.86555559.91+55
June 250919,020,423101,608,75918.72+8.8110555518.92+50
December 251110,738,334102,902,46010.44-8.285755510.27-48
June 251410,688,08897,630,30710.95+0.516055510.81+3
December 251614,478,762100,306,05414.43+3.498055514.41+20
June 251910,113,169100,644,70010.05-4.395655510.09-24
December 25218,300,761101,322,0298.19-1.86455558.11-11
June 25246,779,180101,760,9166.66-1.53375556.67-8
December 25267,357,460107,942,2036.82+0.15365556.49-1
June 25297,224,141108,438,0226.66-0.15355556.31-1
December 25313,888,619107,734,5003.61-3.05185553.24-17
June 25345,938,895107,467,4335.53+1.92295555.23+11

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Truth Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393

BillCreatedVoting startedVoteBill StatusResult
International TradeAugust 2545March 2546defeated
The national refugee policyMay 2545May 2545defeated
Travel by foreigners to the nationApril 2545April 2545defeated
Eminent Domain compensationNovember 2544March 2545defeated
Government policy on energy generationSeptember 2544September 2544defeated
Cabinet Proposal of June 2544June 2544June 2544defeated
Government policy on the nation's power grid.June 2544June 2544passed
National Fire DepartmentMarch 2544March 2544defeated
Repeal: Death Penalty for Capital Crimes ProposalDecember 2543December 2543passed
Civil DisobedienceDecember 2543December 2543defeated
Education of the CivilizationDecember 2543December 2543defeated
Energy Deregulation ActDecember 2543December 2543defeated
Government policy on nuclear powerNovember 2543November 2543defeated
Cabinet Proposal of August 2543August 2543October 2543defeated
The government's policy concerning the post officeMarch 2543August 2543defeated
Funding of public transport (where applicable)February 2543August 2543passed
The government policy regarding housingFebruary 2543August 2543defeated
Train Operating Companies (TOC)December 2542August 2543passed
The government's policy regarding Child BenefitOctober 2542October 2542defeated
Repeal: Death Penalty for Capital Crimes ProposalAugust 2542August 2542defeated

Random fact: Don't put "the" as the first word in your party name, because when parties are referred to in news reports, their names are preceded with "the", e.g. the [Socialist Party] has lost.

Random quote: "In all recorded history there has not been one economist who has had to worry about where the next meal would come from." - Peter Drucker

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51