Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5474
Next month in: 03:30:57
Server time: 16:29:02, April 24, 2024 CET
Currently online (3): ADM Drax | lulus | R Drax | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Liberty Party[?]

This page contains information about the Liberty Party.

This party is inactive.

Details

User[?]: Crossroadsman

Nation[?]: Trigunskaya Imperiya (Trigunia)

Seats[?] in Императорская Дума; tr. Imperatorskaya Duma (Imperial Duma)[?]: 0

Color[?]:

 

Description[?]:

The oldest party in Trigunia, the Liberty Party believes that Liberty, the first of Trigunia's three pillars of belief, is the most important principle in politics and the key to Opportunity and Prosperity.

The Liberty Party also believes that government depends for its legitimacy on the transparency and integrity of the process.

We recognise that politics is an evolutionary process and thus are always keen to discuss principles and policies with other interested parties at any time.

The Liberty Party's position on key issues*:


RELIGION

Freedom of religion is an essential part of The Liberty Partys political view, and indeed, to the extent that religious expression does not interfere with the rights of others, it should be an absolute right.

The Liberty Party believes that there are two key components to ensuring freedom of religion:
1. An absolute division between church and state;
2. A constitutional recognition of freedom of expression as an inalienable right.

Specific policies would include:

- The State does not intervene in the appointment of ministers of any religion whatsoever.
- The State does not intervene in the remuneration of ministers of religion.
- If public schools exist, teacher-led school prayer (or any other promotion of a specific religion or faith generally) would be forbidden in public schools.


CIVIL LIBERTIES

The Liberty Party is, predictably, the truest defender of civil liberties.

Civil liberties should be protected by:
1. Constitutional limitations on the legitimate activities of government (which should basically be limited to the maintaining of a military for defence, providing an independent judiciary for the redress of harms suffered by individuals);
2. Constitutional recognition of specific rights, such as
- freedom of expression;
- privacy;
- sovereignty of the person;
- freedom of contract
- right to own and bear arms;
- right to be free from unreasonable searches;
- freedom of association;
- All individuals are equal before the law.

Specific key policies include:

- No State identity cards (passports are permissible but the State cannot demand sight of it except at border crossings);
- Abortion is allowed during the first and second trimester;
- Euthanasia is allowed with consent from patient;
- Organ donations are legal with personal consent (note that assumed content is a breach of the sovereignty of the person and would therefore be unacceptable);
- There are no laws regulating what citizens can put into their bodies;
- Gambling is legal across the nation, no regulation what so ever;
- Pornography depicting consenting adults is legal;
- Prostitution is legal and a recognized profession;


ECONOMICS

The Liberty Party believes in freedom, and that includes the freedom to enter into contracts with others. It is coincidental that the free market also produces the greatest wealth (we would support it for reasons of liberty even if state intervention could produce greater wealth).

Taxation should be low, be based on consumption rather than income (or anything else), and the extent of the States permission to tax the public should be clearly defined at a Constitutional level. The tax charge should be made as clear as possible (e.g., by ensuring that sales tax is clearly separated on the pricing of goods from the pre-tax amount, so that the consumer can see how much tax he is paying on every item). The government should also be obliged to prepare and publish (making freely accessible to everyone) annual financial statements prepared insofar as possible with international GAAP, so that everyone can judge the profligacy or otherwise of government.

Specific policies include:
- The government does not intervene in the market nor provide any form of subsidies/relief to industries;
- The state does not impose import duties or tariffs on any goods
- Trades unions may exist and worker membership is voluntary (indeed, to have it otherwise would contravene freedom of association);
- All workers have the right to strike but employers have the right to summarily dismiss striking workers who have employment contracts for breach of contract (otherwise freedom of contract would be contravened);
- There is no eminent domain.


CRIME AND LAW ENFORCEMENT

The Liberty Party is tough on crime, however only actions which cause actual harm to another can be crimes.

Specific policies include:
- The death penalty is illegal and never to be applied;
- Police officers carry standard firearms;
- All defendants in criminal trials (and in civil cases where the State is the plaintiff) are entitled to legal aid
- Torture is never to be permitted (where information was extracted by torture, regardless of the jurisdiction in which the torture took place, it shall be inadmissible in court)


EDUCATION

The Liberty Party diverges from most libertarians on the issue of education. The Liberty Party believes that it is appropriate that the State fund education (financed through taxation) for the following reasons:

1. Education raises income levels for those who receive it and education funding can be seen as a loan advanced by the State to the individual to be repaid by future taxes;
2. A good education is an essential component in the individual gaining the competence to properly manage his own affairs, and importantly to critically assess the performance of the government (put another way, public ignorance benefits a tyrant).

The Liberty Party would institute a voucher system. The State absolutely should have no role in education beyond providing the vouchers for individuals.

The Liberty Party also would support continuing education (i.e., beyond school leaving) low interest loans to the public because learning need not stop when you become an adult, and those who most need it are likely to have the lowest access to credit).


SOCIAL SECURITY

The Liberty Party believes in individual freedom, which includes the individuals freedom to plan for his future as he sees fit. As such, it would be inappropriate for the State to impose a state pension scheme on the public.


SCIENCE AND TECHNOLOGY

The Liberty Party believes that the State should not interfere in matters of science and technology.

The following are examples of specific policies:

- Patents are not obtainable. The State does not recognise foreign patents;
- Copyright does not exist. The State does not recognise foreign copyrights;
- Space exploration and use shall be totally unregulated;
- The government does not subsidise research nor does it offer research tax credits.


ECOLOGY

The Liberty Party supports a two-pronged approach to the environment. The policy is based on recognising that environmental damage is a cost and thereby requiring polluters to account for that damage.

Details to be inserted in due course




* We recognise that some major issues have not been specifically mentioned above. Generally our position on these issues is likely to be obvious from our principles (e.g., there is no mention above of the legality of gays serving in the military; however, since there is no statement that the government would be specifically granted the authority to discriminate against individuals in this way it follows that a Liberty government would not obstruct gays serving in the military (indeed the Constitution would prohibit such an obstruction)).

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistlimitedperfect
Government Responsibilitiesextreme small governmentmoderateperfect
Marketmoderate laissez-fairehighperfect
Militarypacifist-leaningmoderateperfect
Moralitymoderate progressiveclose to noneperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 20901,272,98217,336,8437.34+7.34405557.21+40
March 20932,904,67719,820,78014.65+7.318255514.77+42
March 20965,492,73120,237,46827.14+12.4914855526.67+66
March 20992,916,67324,899,54511.71-15.436655511.89-82
March 21026,088,33023,204,26926.24+14.5214955526.85+83
November 21033,634,23323,180,13515.68-10.568755515.68-62
November 21064,858,38325,297,41619.21+3.5310655519.10+19
February 21084,628,82123,099,04920.04+0.8311055519.82+4
February 21117,888,08931,191,03925.29+5.2513955525.05+29
January 21137,485,48927,866,86426.86+1.5715155527.21+12
January 21165,583,69529,270,26419.08-7.7910555518.92-46
January 21194,955,27928,992,11417.09-1.989555517.12-10
January 21224,868,47429,064,79916.75-0.349355516.76-2
January 21255,688,40331,729,30617.93+1.189955517.84+6
January 21284,254,10633,176,10212.82-5.117155512.79-28
January 21315,307,58734,444,60815.41+2.598555515.32+14
May 21345,835,57935,265,05816.55+1.149255516.58+7
May 21375,412,93535,668,31915.18-1.378555515.32-7
November 21385,385,94435,677,21915.10-0.088555515.32+0
November 21414,875,59037,610,14212.96-2.137155512.79-14
November 21445,806,17537,164,27515.62+2.668855515.86+17
September 2145000.00-15.626755512.07-21
July 21466,021,20239,201,56015.36+15.368655515.50+19
July 21494,705,92131,305,33915.03-0.338355514.95-3
July 21525,522,96531,347,41217.62+2.599855517.66+15
July 21555,917,37833,806,56417.50-0.119855517.66+0
July 21585,858,46839,263,05214.92-2.588455515.14-14
July 21616,351,73840,847,07015.55+0.638655515.50+2
October 21646,579,45644,116,61114.91-0.648255514.77-4
October 21675,412,90741,507,56713.04-1.877355513.15-9
October 21706,016,79642,710,88614.09+1.057855514.05+5
October 21737,245,32142,749,52116.95+2.869555517.12+17
October 21768,364,86344,617,08718.75+1.8010455518.74+9
October 21797,909,49943,696,54618.10-0.6510255518.38-2
October 21828,298,72844,469,25318.66+0.5610655519.10+4
October 21857,637,96946,737,16316.34-2.329155516.40-15
October 21887,177,83546,911,59315.30-1.048555515.32-6
October 21917,986,41546,991,37817.00+1.699455516.94+9
October 21947,872,46746,942,82016.77-0.239355516.76-1
October 21976,293,39246,154,12713.64-3.137455513.33-19
October 22005,737,74246,395,60412.37-1.276955512.43-5
October 22036,522,47446,250,49914.10+1.747755513.87+8
October 22067,105,86546,736,61115.20+1.108555515.32+8
October 22094,851,64946,944,21410.33-4.875855510.45-27
October 22124,867,54848,179,61810.10-0.235655510.09-2
October 22156,028,10748,472,64812.44+2.336955512.43+13
October 22186,679,68248,542,54413.76+1.327655513.69+7
October 222110,384,33148,049,68921.61+7.8512255521.98+46
October 222411,544,65448,985,21723.57+1.9613155523.60+9
October 222712,010,85249,981,78024.03+0.4613555524.32+4
October 223012,228,83150,254,70024.33+0.3013755524.68+2
October 223312,705,56048,683,44626.10+1.7614755526.49+10
October 223621,350,73453,202,36940.13+14.0322455540.36+77
October 223915,648,52053,693,55029.14-10.9916355529.37-61
October 224214,213,28654,022,76926.31-2.8314855526.67-15
October 224515,090,82755,194,79727.34+1.0315355527.57+5
October 224819,913,40049,785,26440.00+12.6622355540.18+70
October 225122,014,57850,100,73343.94+3.9424455543.96+21
October 225431,577,34151,171,06261.71+17.7733855560.90+94
October 225720,475,78654,262,93237.73-23.9721255538.20-126
October 226019,745,77656,213,60535.13-2.6119655535.32-16
October 226320,823,22055,182,91337.73+2.6121155538.02+15
May 226527,097,84154,737,27349.51+11.7727755549.91+66
May 226817,047,15252,946,46432.20-17.3118055532.43-97
May 227115,499,04051,671,42730.00-2.2016755530.09-13
May 227418,333,00251,929,50135.30+5.3119755535.50+30
May 227721,137,28443,692,52248.38+13.0727555549.55+78
May 228034,275,27960,158,48456.97+8.6031955557.48+44
May 228335,785,76558,221,08961.47+4.4934355561.80+24
May 228636,161,51159,392,95260.89-0.5833955561.08-4
May 228943,268,69757,728,34374.95+14.0742055575.68+81
May 229244,201,74756,652,77478.02+3.0743755578.74+17
May 229543,249,17455,648,53777.72-0.3043655578.56-1
May 229842,186,92655,309,02576.27-1.4442955577.30-7
May 230142,52368,167,8760.06-76.2105550.00-429
May 230447,51062,088,3070.08+0.0105550.00+0
March 230510,352,89261,803,10516.75+16.679455516.94+94
March 230822,871,76347,232,47448.42+31.6726955548.47+175
March 231126,760,76363,679,64142.02-6.4023355541.98-36
March 231427,910,47266,182,84642.17+0.1523455542.16+1
January 231713,279,21053,695,85524.73-17.4413755524.68-97
January 232011,613,54352,439,10722.15-2.5812355522.16-14
October 232213,445,43651,444,75826.14+3.9914355525.77+20
October 232513,451,00560,151,16822.36-3.7712455522.34-19
September 232814,383,84958,444,87024.61+2.2513655524.50+12
March 233116,934,19558,678,20228.86+4.2515655528.11+20
March 233420,515,19758,814,60334.88+6.0219055534.23+34
January 233622,898,69459,539,03638.46+3.5821355538.38+23
May 233817,305,82738,409,32645.06+6.6025055545.05+37
May 234115,631,87851,891,92930.12-14.9316555529.73-85
March 234424,523,81870,201,16534.93+4.8119455534.95+29
March 234723,984,71670,441,46634.05-0.8818955534.05-5

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Liberty Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423

BillCreatedVoting startedVoteBill StatusResult
Gosoodarstvyenniye sryedstva massovoy informatsiiFebruary 2873February 2873passed
Byezopasniy voyennihFebruary 2873February 2873defeated
Localnaya GovernanciyaJanuary 2873January 2873passed
Soyudeniye EducatciyeOctober 2872October 2872passed
Stroika Abundiniyi'h GorodovOctober 2872October 2872passed
Cabinet Proposal of October 2872October 2872October 2872passed
Новые административные названияMarch 2872December 2872passed
общественный образование счетFebruary 2872February 2872defeated
короткий управление счетFebruary 2872February 2872passed
национальный обслуживание счетFebruary 2872February 2872defeated
религиозный счетFebruary 2872February 2872defeated
экономика счетFebruary 2872February 2872defeated
Ratification of the UKSR-Egelion Peace TreatyMarch 2871March 2871passed
Cabinet Proposal of August 2870August 2870August 2870passed
Proletarian Paradise ReformsAugust 2870August 2870passed
Proleterian Rights BillFebruary 2866February 2866defeated
Equal Presentation BillJune 2865June 2865defeated
National Forest Preservation BillJune 2865June 2865defeated
Equal Service BillJune 2865June 2865defeated
National Service BillJune 2865June 2865defeated

Random fact: Real-life places should not be referenced in Particracy.

Random quote: "Capitalism and communism stand at opposite poles. Their essential difference is this: the communist, seeing the rich man and his fine home, says: 'No man should have so much.' The capitalist, seeing the same thing, says: 'All men should have as much.'" - Phelps Adams

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51