Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5471
Next month in: 01:29:15
Server time: 22:30:44, April 18, 2024 CET
Currently online (5): burgerboys | Dx6743 | hexaus18 | hvnly6in | wstodden2 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Selucian Home and Hearth[?]

This page contains information about the Selucian Home and Hearth.

This party is inactive.

Details

User[?]: kementari

Nation[?]: Principatus Selucianus (Selucia)

Seats[?] in Senātus Populī[?]: 0

Color[?]:

 

Description[?]:

BREAD AND THE OPEN SEA

There is no point in repeating the usual platitudes. Bread and the sea: it is a subject we will tackle here.

Many years ago, before bread, there was the sea. Then one day in the fifteenth century there was bread. Many people worried about the consequences of having both bread and the sea. And there was good reason to worry.

But now we are past all that. We live in a world where we no longer have to worry about rivalries and vengeance, at least as they pertain to bread and the sea. But will it always be this way? We have treaties, and strong nets, and the one wall, but is it enough? Some would say it is not enough.

But what can we do? We cannot live in fear. We cannot hide in our shelters or wear dark cloaks and thigh-high boots. We have to go on living. We have to ride our bicycles and fly our kites and tie our friends in the shed with rope and duct tape. We have to live. There may come a day when the sea and bread find a way to again bring their differences to our front porch. It could be tomorrow. Or next year. You could be dead by that time. But if you are not dead, you could be at work, drinking soda and writing words on paper - or typing them. And then the sound of conflict will come into your ears, accompanied by a bright light, and the unmistakable heat of eternal fire.

--------------------------------------------------------------------------------

IMPERATORS

Aethelred the Unready (Green Moderate Party) 2192-2196
Eva Metrophanes I 2669-2677
Eva Metrophanes II 2719-2725
Eva Metrophanes III 2728-2758
Eva Metrophanes IV 2776-2794
Eva Metrophanes V 2807-present

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightspermissive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiesmoderate small governmentmoderateperfect
Marketmoderate regulatormoderateperfect
Militarymoderate pacifistmoderateperfect
Moralityconservative-leaningmoderateperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 2580785,554152,264,5960.52+0.5225000.40+2
September 258214,290,285151,890,5769.41+8.89465009.20+44
December 258511,402,892148,739,1987.67-1.74375007.40-9
July 258911,647,016141,318,7208.24+0.58415008.20+4
July 25938,126,957145,586,7935.58-2.66275005.40-14
July 259710,965,748144,038,0717.61+2.03375007.40+10
July 26018,076,483145,990,2665.53-2.08275005.40-10
March 260212,662,046141,640,3018.94+3.41455009.00+18
March 260613,682,214141,425,3039.67+0.73485009.60+3
March 261015,678,829144,973,73110.81+1.145250010.40+4
March 261413,696,957148,599,2429.22-1.60465009.20-6
March 261812,766,010148,532,2458.59-0.62435008.60-3
January 262130,590,215146,992,21520.81+12.2210450020.80+61
January 262529,490,153151,533,39119.46-1.359850019.60-6
January 262931,122,598151,557,32820.54+1.0710350020.60+5
January 263328,942,557151,080,80619.16-1.389550019.00-8
January 263744,073,683172,702,29825.52+6.3612850025.60+33
May 264039,830,841138,800,76928.70+3.1814250028.40+14
May 264454,916,002158,600,65434.63+5.9317550035.00+33
May 264847,623,444148,120,83832.15-2.4716450032.80-11
May 265232,944,886155,608,41721.17-10.9810650021.20-58
May 265623,693,702153,196,29515.47-5.717750015.40-29
August 265815,955,454124,954,54512.77-2.706350012.60-14
August 266229,303,582165,950,79017.66+4.898850017.60+25
August 266631,273,750166,030,99818.84+1.189550019.00+7
June 266945,180,725172,596,52526.18+7.3412950025.80+34
June 267345,230,508169,554,43226.68+0.5013350026.60+4
June 267731,808,109195,363,15916.28-10.3912275016.27-11
February 268016,026,438177,241,0649.04-7.24697509.20-53
October 268216,103,072176,256,5029.14+0.09707509.33+1
January 268312,717,930138,969,5999.15+0.02707509.33+0
September 268511,020,858203,336,7195.42-3.73407505.33-30
October 268611,106,882197,620,2835.62+0.20417505.47+1
June 268910,507,557183,316,3145.73+0.11407505.33-1
December 268920,032,511192,834,94510.39+4.668075010.67+40
June 269221,644,481189,230,79211.44+1.058675011.47+6
August 269435,868,882190,451,09818.83+7.4014375019.07+57
August 269728,680,806181,847,73315.77-3.0612075016.00-23
August 270026,801,354192,886,62513.89-1.8810675014.13-14
August 270329,473,363197,297,70914.94+1.0411675015.47+10
April 270637,197,224175,879,91221.15+6.2116475021.87+48
September 270743,037,227210,778,08320.42-0.7315475020.53-10
September 271046,033,762199,016,55623.13+2.7117375023.07+19
September 271336,427,612187,997,70819.38-3.7514275018.93-31
September 271652,095,063199,164,09626.16+6.7819075025.33+48
September 271958,121,425202,471,49428.71+2.5521175028.13+21
September 272261,556,095185,056,25733.26+4.5624775032.93+36
September 272556,479,462181,275,14131.16-2.1123275030.93-15
September 272865,080,202183,434,53335.48+4.3226775035.60+35
September 273174,793,099134,222,85255.72+20.2441875055.73+151
September 2734109,398,199209,871,68152.13-3.6039075052.00-28
September 2737128,659,065203,524,78863.22+11.0947375063.07+83
September 274090,034,046144,048,05062.50-0.7145675060.80-17
September 274386,307,239139,445,01861.89-0.6145275060.27-4
September 274698,302,627141,051,87169.69+7.8051075068.00+58
September 274980,615,223140,104,29357.54-12.1529150058.20-219
September 275287,111,939138,784,09462.77+5.2331250062.40+21
September 275581,429,191136,893,30459.48-3.2829950059.80-13
September 275843,007,873198,914,80221.62-37.8612850025.60-171
September 276118,758,135205,402,2999.13-12.495150010.20-77
September 276465,432,416131,657,25449.70+40.5725050050.00+199
September 276771,502,455209,338,57034.16-15.5419350038.60-57
September 277063,602,736215,179,92829.56-4.6016150032.20-32
September 277322,386,528203,430,45511.00-18.557850015.60-83
January 277649,704,29949,831,73599.74+88.74500500100.00+422
January 277949,388,50649,521,98199.73-0.01500500100.00+0
January 278249,938,19550,272,16699.34-0.39500500100.00+0
January 278551,428,86251,588,58699.69+0.35500500100.00+0
January 2788173,148,318229,134,59075.57-24.1237850075.60-122
January 279177,295,015225,761,50434.24-41.3317050034.00-208
January 279471,237,915270,187,61226.37-7.8713450026.80-36
August 2804143,976,511205,279,46370.14+43.7734450068.80+210
May 280753,528,48553,528,485100.00+29.86500500100.00+156
May 2813266,831,528267,389,19999.79-0.21500500100.00+0
January 2817250,906,903284,655,06588.14-11.6544150088.20-59
January 282354,667,01754,667,017100.00+11.86500500100.00+59

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Selucian Home and Hearth.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471

BillCreatedVoting startedVoteBill StatusResult
Civil Liberties BillDecember 3274June 3275defeated
Minimum Wage BillDecember 3272June 3273defeated
Income tax proposal of November 3272November 3272November 3272passed
KLP omnibus for the electionApril 3272April 3272passed
Income tax proposal of April 3272April 3272April 3272passed
Cabinet Proposal of February 3272February 3272February 3272defeated
Budget proposal of August 3271August 3271August 3271passed
Cabinet Proposal of August 3271August 3271August 3271passed
Cabinet Proposal of April 3271April 3271April 3271defeated
Cabinet Proposal of February 3271February 3271February 3271defeated
KLP omnibusOctober 3268April 3270defeated
Income tax proposal of February 3268February 3268May 3268passed
Cabinet Proposal of November 3267November 3267February 3268passed
Free Market ActMay 3267May 3267defeated
Pre school education centralisation and safeguarding ActApril 3266November 3266passed
Mayor election billMarch 3266September 3266defeated
Budget proposal of March 3266March 3266April 3266passed
Cabinet Proposal of March 3266March 3266March 3266passed
Eminent Domain Compensation BillNovember 3265November 3265passed
Inidrec taxtation Act of 3264September 3264August 3265passed

Random fact: To see what other nations are up to and to actively involve yourself in international activities: check the Roleplaying section on the forum! Don't be shy to make a news post about your party's recent achievements.

Random quote: "The trouble with practical jokes is that very often they get elected." - Will Rogers

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51