Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5504
Next month in: 00:52:24
Server time: 19:07:35, June 25, 2024 CET
Currently online (9): lulus | mccartja00 | MrFacts | Paulo Nogueira | R Drax | rapop102 | SE33 | UnknownMole | ZulanSol | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Liberty Party[?]

This page contains information about the Liberty Party.

This party is inactive.

Details

User[?]: sthammer

Nation[?]: Hobratsuri Respublika (Hobrazia)

Seats[?] in Erovnuli Asamblea (National Assembly) [?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightspermissive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate laissez-fairemoderateperfect
Militarymoderate militaristmoderateperfect
Moralityconservative-leaninghighperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 375841,80462,916,1750.07+0.0703250.00+0
April 376112,378,51445,301,48027.32+27.2611040027.50+110
April 376413,778,45351,781,40126.61-0.7211040027.50+0
April 376712,763,14452,549,56524.29-2.3210040025.00-10

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Liberty Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348

BillCreatedVoting startedVoteBill StatusResult
Determining Adulthood Policy ReformJune 3804December 3804defeated
Welfare Reform of 3804May 3804May 3804passed
Open Industry Act of 3804January 3804January 3804passed
Hobrazian Stimulus Act of 3804November 3803March 3804passed
Military Preparedness ActNovember 3803November 3803passed
Tax Reform of 3803November 3803November 3803passed
Educational Empowerment Act of 3803November 3803November 3803passed
Moral Restoration Act of 3804November 3803November 3803passed
Cabinet Proposal of October 3803October 3803October 3803passed
Increasing timeJune 3803May 3804defeated
Constitutional Amendments of 3803May 3803October 3803passed
Food BillJanuary 3803January 3803passed
Economic Opportunity ActOctober 3802October 3802defeated
Foreign Policy Reform ActAugust 3802August 3802passed
Eminent Domain BillAugust 3802August 3802passed
Environment BillJuly 3802July 3802defeated
Morality BillJuly 3802July 3802defeated
Reduction of Corporate TaxJuly 3802July 3802defeated
Military Revitalization ActJuly 3802July 3802passed
Schools of Choice ActJuly 3802July 3802passed

Random fact: "OOC", "IC" and "IG" are commonly-used acronyms in Particracy. "OOC" refers to comments, discussions and actions which are out-of-character, meaning they are done player-to-player rather than party-to-party. "IC" refers to in-character interactions (ie. party-to-party). Similarly, "IG" means in-game, although this term may also simply refer to what happens in the actual game interface, as opposed to on the forum or elsewhere. "RP" just means "role-play".

Random quote: "A democracy that does not allow limits is not a democracy. Just as a limitless freedom is not freedom, but prevarication. Indeed, any theory of freedom worthy of this name is first of all a limit theory. If we extend the unlimited tolerance even to those who are intolerant, if we are not willing to defend a tolerant society against the attacks of the intolerants, then the tolerants will be destroyed and the tolerance with them! Because, I ask to myself and ask you, given a certain system that we call democratic, which is today the best possible system to allow everyone to live freely and to be able to express their own thoughts, how can the same system admit attacks against its integrity? How can a system refuse the principle of the self-preservation? For this reason, to suppress the apologetics of thalerrism, it's for this reason that the exaltation of exegetes, principles, facts or methods of Thallerism and its anti-democratic aims does not constitute a violation of the freedom of manifestation of thought, but, on the contrary, the celebration of that freedom. The protection of the first premise on which a modern democratic system is based. And this premise must be safeguarded also and above all against itself and its abuses." ~ Malik Astori, Leadership of Liberty and Progress (Istalia)

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52