Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: November 5490
Next month in: 01:57:12
Server time: 10:02:47, May 29, 2024 CET
Currently online (1): PiratDun | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Kundrati Imperialists[?]

This page contains information about the Kundrati Imperialists.

This party is inactive.

Details

User[?]: TheOneTruePi

Nation[?]: Kundrati Union (Kundrati)

Seats[?] in Legebiltzarra/Národná rada (National Legislature)[?]: 0

Color[?]:

 

Description[?]:

Party Heads:
Head of Party: Thracius Antonina
Deputy Head of Party: Lucianus Seneca
Head of Senate: Horatia Claudius
Deputy head of Senate: Crispus Caecilia
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
The Kundrati Imperialists wish to reinstate the monarchy of Kundrati under the Imperator with elected Consul of the Senate. TKI stands for tradition, state controlled industry and the Kundrati Moral values.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistclose to noneperfect
Government Responsibilitiesbig government-leaningmoderateperfect
Marketconvinced regulatormoderateperfect
Militaryconvinced militaristlimitedperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 416341,48057,436,0360.07+0.0705410.00+0
December 416618,32161,150,1700.03-0.0405410.00+0
December 417839,04458,797,1820.07+0.0405410.00+0
December 41873,449,12859,153,6295.83+5.76355776.07+35
January 41908,959,43161,050,11514.68+8.848757715.08+52
January 41937,754,99860,887,95212.74-1.947557713.00-12
January 41968,650,33656,976,34815.18+2.459357716.12+18
January 41999,259,73453,710,66217.24+2.0611357719.58+20
January 420213,038,83752,564,76224.81+7.5714057724.26+27
January 42055,247,30659,354,8358.84-15.96505778.67-90
January 42074,699,58159,392,9367.91-0.93445777.63-6
January 421012,039,09456,404,23221.34+13.4312557721.66+81
January 421310,590,69845,009,72823.53+2.1914560024.17+20
February 429329,543,77860,144,41949.12+25.5930261549.11+157
July 517711,779,85653,003,07422.22-26.909945022.00-203

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Kundrati Imperialists.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346

BillCreatedVoting startedVoteBill StatusResult
Right to Collective Bargaining ActSeptember 5342September 5342defeated
Estatuko Legea Kolapsatu (Collapse the State)August 5342August 5342defeated
Immigration for Open Doors Act 5341October 5341October 5341passed
Drug Act 5341July 5341July 5341passed
ODLS-029 / Worker Empowerment in Corporate Decision-Making (WECDeM) Act (refiling coz im dumb)June 5340June 5340passed
ODLS-029 / Worker Empowerment in Corporate Decision-Making (WECDeM) ActOctober 5339October 5339defeated
Mayor Electoral Reform ActJuly 5339July 5339passed
Eminent Domain Reform ActJuly 5339July 5339passed
Parental Qualifications Disavowal ActJanuary 5339April 5339defeated
Religious Taxation ActJanuary 5339April 5339defeated
Adoption Reform ActJanuary 5339April 5339passed
Abortion Funding for Low Income ActJanuary 5339April 5339passed
Selective Schools Act 5339January 5339April 5339defeated
Employee Representation Act 5337August 5337August 5337passed
ODLS-030 / Merit-Based Educational Institutions Act of 5340December 5336July 5340passed
Internet Service Regulations Act 5335December 5335December 5335defeated
World Congress Bill 5335December 5335December 5335passed
Monopolies Act 5335December 5335December 5335defeated
Cabinet Proposal of August 5335August 5335August 5335passed
Art Subsidy Bill 5335August 5335August 5335passed

Random fact: Before choosing a nation, you may wish to research it first. For more information on the cultural backgrounds of the nations, please see the Cultural Protocols Index: http://forum.particracy.net/viewtopic.php?f=11&t=6365

Random quote: "Let's call the drug war what it is, ethnic cleansing of Americans." - Jello Biafra

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51