Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5573
Next month in: 01:14:05
Server time: 22:45:54, November 24, 2024 CET
Currently online (1): THD | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Naprijed / Forward[?]

This page contains information about the Naprijed / Forward.

This party is inactive.

Details

User[?]: myunggg

Nation[?]: Kundrati Union (Kundrati)

Seats[?] in Legebiltzarra/NΓ‘rodnΓ‘ rada (National Legislature)[?]: 0

Color[?]:

 

Description[?]:

🧑 𝙉𝙖π™₯π™§π™žπ™Ÿπ™šπ™™ / 𝙁𝙀𝙧𝙬𝙖𝙧𝙙 🧑
Stronger together, forward forever.

π—Ÿπ—˜π—”π——π—˜π—₯π—¦π—›π—œπ—£
β€£ Co-Executive Leaders: Fili Dreshaj / Yanitsa Cowles-Dimitrova
β€£ Co-Parliamentary Group Whips: Jovce Andreev / Delmina Strakosha-Botev
β€£ Secretaries-General: Tsvetan Todorov Hristov / Sandra BenčiΔ‡-BoΕΎo
‣ Co-Backbench Leaders: Mikota Barjaktarović / Zañe Ajuria-Johnson
β€£ Women For the Future Chair: Sandra BenčiΔ‡-BoΕΎo
‣ Kundrati Youth on the Move Chairs: Stefan Momchilov Pramatarov / Lemoiz Uriartecheandia-Vuković


π—ͺπ—›π—˜π—₯π—˜ π—ͺπ—˜ 𝗦𝗧𝗔𝗑𝗗
We believe in a Kundrati where everyone takes part in solving the challenges we face as a nation, ensuring the greater good of all. In pursuing this vision, we stand for the following.

β€£ STRONGER WORKERS TO KEEP THE ECONOMY RUNNING | We want a country that works for working people, with decent, well-paid jobs no matter where you live and where good businesses can thrive.
β€£ STRONGER COMMUNITIES FOR SAFETY AND SECURITY | We want a country where people feel happy, safe and part of a close-knit community, with low levels of crime and proper support for victims.
β€£ STRONGER SERVICES FOR A HEALTHIER POPULACE | We want a country with world-class public services that work for everyone right from the start, from a national health service to quality education, social care, children’s and youth services to housing.
β€£ STRONGER FUTURE FOR ECOLOGY AND DIGITALIZATION | We want a country that takes on environmental challenges and seizes the opportunities of the digital revolution, not one whose leaders duck the big challenges.
β€£ STRONGER FAMILIES IN DIVERSE FORMS | We want a country where families come first, in all of their wonderful diversity, so Kundrati becomes the best place in the world to grow up and to grow old in.
β€£ STRONGER KUNDRATI TO PROMOTE GREATER FREEDOMS | We want a country that is self-confident on the world stage, with an international role to deliver for the Kundrati people while making our world safer, freer, and more democratic.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsextreme internationalistlimitedperfect
Government Responsibilitiesmoderate big governmenthighperfect
Marketlaissez-faire-leaninglimitedperfect
Militarymoderate pacifistlimitedperfect
Moralityconvinced progressivelimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 51435,537,59761,899,0248.95+8.95424509.33+42
August 51464,554,66960,243,8997.56-1.39334507.33-9
August 51499,050,68559,004,43815.34+7.786745014.89+34
August 51544,010,84265,321,3606.14-9.20274506.00-40

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Naprijed / Forward.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347

BillCreatedVoting startedVoteBill StatusResult
Bestiality BanSeptember 3342September 3342defeated
Cross Dressing ActSeptember 3342September 3342passed
Firearms ActSeptember 3342September 3342defeated
Inheritance ActSeptember 3342September 3342passed
Fire Brigade PolicySeptember 3342September 3342defeated
Nuclear Power ActSeptember 3342September 3342passed
Public Transport ActSeptember 3342September 3342defeated
Public Works Standardisation ActSeptember 3342September 3342defeated
Housing Subsidisation ActSeptember 3342September 3342defeated
Religous Propaganda ActSeptember 3342September 3342passed
Religous Schools ActSeptember 3342September 3342passed
Call for early elections, February 3342February 3342February 3342passed
Amendment to Eminent Domain ActDecember 3341June 3342passed
Basic Income GuaranteeDecember 3341June 3342defeated
Refugee Policy ActDecember 3341June 3342defeated
Cabinet Proposal of April 3341April 3341April 3341passed
Stock Exchanges ActMarch 3341March 3341defeated
Eminent Domain ActMarch 3341March 3341passed
Intelligence Agency ActMarch 3341March 3341defeated
Cabinet Proposal of July 3340July 3340December 3340passed

Random fact: Particracy does not allow role-play that seems to belong to the world of fantasy, science fiction and futuristic speculation.

Random quote: "I'll see you in the Palace in Kivonia once we win this war... and I'm ecstatic to be the one to execute you. Sleep well." - Queen Annalise, former Telamonese monarch

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51