Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5492
Next month in: 02:44:49
Server time: 05:15:10, June 02, 2024 CET
Currently online (1): wstodden2 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Dimokratikos Synaspismos[?]

This page contains information about the Dimokratikos Synaspismos.

This party is inactive.

Details

User[?]: Zeus

Nation[?]: Kalopikí Dimokratía (Kalopia)

Seats[?] in Vouli (Κοινοβούλιο)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiesmoderate big governmentmoderateperfect
Marketmoderate regulatorhighperfect
Militarymilitarist-leaningmoderateperfect
Moralitymoderate progressivemoderateperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 484411,815,23011,815,230100.00+100.00350350100.00+350
August 484817,057,17350,913,48333.50-66.5010030033.33-250
August 485224,323,12256,354,41243.16+9.6612930043.00+29
August 485622,673,90354,705,52841.45-1.7112330041.00-6
August 486024,276,80654,989,67244.15+2.7013130043.67+8

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Dimokratikos Synaspismos.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350

BillCreatedVoting startedVoteBill StatusResult
Budget proposal of February 3350February 3350February 3350passed
Loosening State TerrorFebruary 3350February 3350passed
Budget proposal of December 3347December 3347December 3347passed
Income tax proposal of October 3347October 3347October 3347passed
Improving Law And OrderApril 3347April 3347passed
Education Reform of 3346May 3346October 3347passed
Budget proposal of May 3346May 3346April 3347passed
Income tax proposal of May 3346May 3346May 3346passed
Fireworks ProhibitionMay 3346May 3346passed
Ecology Reform of 3346May 3346May 3346passed
AgogeApril 3346April 3346passed
Child labourJune 3345April 3346passed
Inheritance ReformJune 3345April 3346passed
DuelingJune 3345April 3346passed
Titles of NobilityJune 3345April 3346passed
Parliamentary PrivilegeJune 3345June 3345passed
Long Live the Imperial Blood Line!June 3345June 3345passed
Health Care Reform of 3346May 3345April 3346passed
SlaveryMay 3345June 3345passed
Eminent Domain Compensation ReformMay 3345June 3345passed

Random fact: Voters have an extra appreciation for bills that actually get passed, so if you want to maximally take profit from your votes, make sure you compromise with others.

Random quote: "I bet their mothers don't love them. Many Trigunian women are so cold. I mean it's a racist hellhole in parts." - Tirza Sommer, former Dorvish politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52