Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5500
Next month in: 03:51:58
Server time: 08:08:01, June 17, 2024 CET
Currently online (2): j9999 | Ost | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Neolibertarian Party[?]

This page contains information about the Neolibertarian Party.

This party is inactive.

Details

User[?]: Nie Alane

Nation[?]: Kalopikí Dimokratía (Kalopia)

Seats[?] in Vouli (Κοινοβούλιο)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistclose to noneperfect
Government Responsibilitiesconvinced small governmenthighperfect
Marketmoderate laissez-fairehighperfect
Militarypacifist-leaninglimitedperfect
Moralityconservative-leaninglimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 21532,39732,313,2900.01+0.0105000.00+0
August 21561,42238,437,0590.00-0.0005000.00+0
August 2159044,712,9450.00-0.0005000.00+0
August 216220,25945,827,0360.04+0.0405000.00+0
August 216536,42441,888,4300.09+0.0405000.00+0
August 216824,72644,622,8560.06-0.0305000.00+0
August 217127,49847,213,8730.06+0.0005000.00+0
August 217418,16747,163,6910.04-0.0205000.00+0
May 217726,20046,327,8650.06+0.0205000.00+0
May 218132,98946,485,5260.07+0.0105000.00+0
May 218536,22047,876,7390.08+0.0005000.00+0
May 2189609,21145,692,9951.33+1.2665001.20+6
August 21901,758,44644,495,4063.95+2.62195003.80+13
January 21943,712,53144,679,3218.31+4.36415008.20+22
June 21964,627,79849,608,4379.33+1.02455009.00+4
June 22004,267,83550,237,5508.50-0.83405008.00-5
June 22044,293,77849,150,8818.74+0.24435008.60+3
June 22084,615,62148,123,8349.59+0.86475009.40+4
July 22123,833,60549,584,4837.73-1.86395007.80-8
June 22157,679,50648,017,40415.99+8.268450016.80+45
June 221912,329,13242,983,21928.68+12.6914450028.80+60
June 222315,561,56846,366,60733.56+4.8816750033.40+23
June 22279,168,35157,244,28316.02-17.558250016.40-85
April 222822,353,28356,255,00139.74+23.7220050040.00+118
April 223212,283,52557,069,03921.52-18.2110850021.60-92
April 22348,047,51051,581,08715.60-5.927750015.40-31
April 223810,619,80354,696,07919.42+3.819750019.40+20
April 22428,462,34545,077,91918.77-0.649250018.40-5
April 224610,760,63555,848,42019.27+0.499550019.00+3

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Neolibertarian Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351

BillCreatedVoting startedVoteBill StatusResult
Private Alternatives 2998March 2998March 2998passed
Income tax proposal of March 2998March 2998March 2998passed
Budget proposal of March 2998March 2998March 2998passed
Raising Salaries 2998December 2997February 2998passed
Cabinet Proposal of December 2997December 2997January 2998passed
Market Socialist Reforms of 2998November 2997March 2998passed
Call for early elections, November 2997November 2997November 2997passed
Population Policy: Quality Before Quantity 2996-2997November 2996November 2996passed
Demographic Register Creation Act of 2996April 2996April 2996passed
Eminent Domain Restrictions 2996April 2996April 2996passed
Budget proposal of April 2996April 2996April 2996passed
Withdraw from the Friends of the Selucian People - Offical List (Constitution of the Selucian Republic)February 2996February 2996passed
Small FarmsJune 2995November 2995passed
Income Equality ActJune 2995November 2995passed
Administrative Reforms of 2995December 2994December 2994passed
Renaming Cities 2995December 2994December 2994passed
Renaming the Regions 2995December 2994December 2994passed
New Flag 2995June 2994December 2994passed
Emigration Act of 2993May 2993May 2993passed
Immigration Act of 2993May 2993May 2993passed

Random fact: Once approved, players should copy Cultural Protocols into a bill in the debate section of their nation page, under the title of "OOC: Cultural Protocols". This bill should include links to the passed Cultural Protocol bill and the Moderation approval.

Random quote: "A conservative is a man with two perfectly good legs who, however, has never learned to walk forward." - Franklin D. Roosevelt

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51