Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5500
Next month in: 01:12:59
Server time: 06:47:00, June 17, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Neolibertarian Party[?]

This page contains information about the Neolibertarian Party.

This party is inactive.

Details

User[?]: Nie Alane

Nation[?]: Kalopikí Dimokratía (Kalopia)

Seats[?] in Vouli (Κοινοβούλιο)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistclose to noneperfect
Government Responsibilitiesconvinced small governmenthighperfect
Marketmoderate laissez-fairehighperfect
Militarypacifist-leaninglimitedperfect
Moralityconservative-leaninglimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 21532,39732,313,2900.01+0.0105000.00+0
August 21561,42238,437,0590.00-0.0005000.00+0
August 2159044,712,9450.00-0.0005000.00+0
August 216220,25945,827,0360.04+0.0405000.00+0
August 216536,42441,888,4300.09+0.0405000.00+0
August 216824,72644,622,8560.06-0.0305000.00+0
August 217127,49847,213,8730.06+0.0005000.00+0
August 217418,16747,163,6910.04-0.0205000.00+0
May 217726,20046,327,8650.06+0.0205000.00+0
May 218132,98946,485,5260.07+0.0105000.00+0
May 218536,22047,876,7390.08+0.0005000.00+0
May 2189609,21145,692,9951.33+1.2665001.20+6
August 21901,758,44644,495,4063.95+2.62195003.80+13
January 21943,712,53144,679,3218.31+4.36415008.20+22
June 21964,627,79849,608,4379.33+1.02455009.00+4
June 22004,267,83550,237,5508.50-0.83405008.00-5
June 22044,293,77849,150,8818.74+0.24435008.60+3
June 22084,615,62148,123,8349.59+0.86475009.40+4
July 22123,833,60549,584,4837.73-1.86395007.80-8
June 22157,679,50648,017,40415.99+8.268450016.80+45
June 221912,329,13242,983,21928.68+12.6914450028.80+60
June 222315,561,56846,366,60733.56+4.8816750033.40+23
June 22279,168,35157,244,28316.02-17.558250016.40-85
April 222822,353,28356,255,00139.74+23.7220050040.00+118
April 223212,283,52557,069,03921.52-18.2110850021.60-92
April 22348,047,51051,581,08715.60-5.927750015.40-31
April 223810,619,80354,696,07919.42+3.819750019.40+20
April 22428,462,34545,077,91918.77-0.649250018.40-5
April 224610,760,63555,848,42019.27+0.499550019.00+3

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Neolibertarian Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351

BillCreatedVoting startedVoteBill StatusResult
ISP Nationalization of 2980-2981October 2980October 2980passed
Launching of the Kalopian Space Programme of 2980-2981October 2980October 2980passed
Child Benefit Act of 2980-2981October 2980October 2980passed
Eminent Domain Compensation 2980-2981October 2980October 2980passed
Call for early elections, June 2980June 2980June 2980passed
Income tax proposal of February 2980February 2980February 2980passed
Cannabis Act of 2979February 2979February 2979defeated
Pension Act of 2979February 2979February 2979passed
Limits On Foreign Investments of 2979February 2979February 2979passed
Toxin Free Food Act of 2979February 2979February 2979passed
Nationalization of Fishing of 2979February 2979February 2979passed
Refugee Policy Act of 2979February 2979February 2979passed
International Aid Act of 2979February 2979February 2979passed
Border Act of 2979February 2979February 2979passed
Prohibitation Of Private Schools of 2979February 2979February 2979passed
Prohibition Of Animal Testing of 2979February 2979February 2979passed
Environmental Protection Act of 2976July 2976July 2976passed
Medicine Act of 2976July 2976July 2976passed
Energy Generation RegulationMarch 2976March 2976defeated
Relieving the Banking SectorMarch 2976March 2976defeated

Random fact: For more information on Particracy's former colonial nations, check out http://forum.particracy.net/viewtopic.php?f=5&t=6640

Random quote: "For every action there is an equal and opposite government program." - Bob Wells

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51