Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 02:56:10
Server time: 17:03:49, November 24, 2024 CET
Currently online (3): Arusu-Gad | j9999 | ProDu | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Partido Santanderista[?]

This page contains information about the Partido Santanderista.

This party is inactive.

Details

User[?]: SDBen

Nation[?]: Dovriges Republik (Davostag)

Seats[?] in Riksdag (National Diet)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristlimitedperfect
Civil Rightsmoderate permissiveclose to noneperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationistlimitedperfect
Government Responsibilitiesunknownclose to noneperfect
Marketextreme regulatorclose to noneperfect
Militarymoderate pacifistlimitedperfect
Moralityconvinced progressivelimitedperfect
Religionmoderate secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
March 25398,619,408110,276,9637.82+7.82111378.03+11
March 254212,766,234107,724,28211.85+4.031613711.68+5
March 254520,359,667115,354,01717.65+5.802513718.25+9
March 254818,940,094112,548,65516.83-0.822413717.52-1
March 25519,848,199113,530,9388.67-8.15121378.76-12
March 255415,649,101115,522,28313.55+4.871813713.14+6
March 255711,064,602115,489,5779.58-3.97111378.03-7
March 256016,476,473116,000,69814.20+4.621913713.87+8
November 256116,325,697122,760,30913.30-0.901813713.14-1
November 256412,208,176118,106,38510.34-2.96131379.49-5
November 25674,183,261122,260,1833.42-6.9131372.19-10
November 25708,688,744123,228,8197.05+3.6381375.84+5
November 257321,256,615125,445,55516.94+9.892513718.25+17
November 257623,135,175126,926,13618.23+1.282613718.98+1
November 257922,694,666128,838,66817.61-0.612413717.52-2
November 258221,402,838113,805,92318.81+1.192513718.25+1
November 258522,406,158112,879,83719.85+1.042813720.44+3
November 258828,366,702132,811,17621.36+1.512913721.17+1
November 259121,596,788126,326,88417.10-4.262513718.25-4
March 259327,900,680127,822,15521.83+4.733013721.90+5
March 259633,620,867127,208,13126.43+4.603613726.28+6
March 259937,019,486139,008,94426.63+0.203713727.01+1
March 260234,198,778139,384,82124.54-2.103313724.09-4
March 26059,710,467141,982,9786.84-17.7081375.84-25

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Partido Santanderista.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385

BillCreatedVoting startedVoteBill StatusResult
Budget proposal of September 2745September 2745February 2746passed
Call for early elections, August 2745August 2745August 2745passed
Death Penalty ActJuly 2745February 2746passed
Prostitution ActJuly 2745February 2746passed
Restoration of Marriage ActJuly 2745February 2746passed
Interrogation Freedom ActJuly 2745February 2746passed
Video Game De-Regulation ActFebruary 2745February 2745passed
Cabinet Proposal of January 2745January 2745July 2745passed
Re-Introduction of Military Improvement ActJanuary 2745January 2745passed
Military Improvement ActAugust 2743August 2743defeated
End Eminent Domain ActMarch 2743March 2743defeated
Constitutional AmendmentDecember 2742January 2745passed
Unsubsidize Bus FaresDecember 2742December 2742defeated
Religious Freedom ActDecember 2742December 2742defeated
Individual Liberty ActDecember 2742December 2742defeated
Business Freedom ActDecember 2742December 2742defeated
Call for early elections, September 2736September 2736September 2736passed
Democratic Socialist Bill: Atheism as the Way ForwardJuly 2736October 2736passed
Democratic Socialist Bill: Welfare for AllJanuary 2736January 2736passed
Democratic Socialist Bill: Sensible Infrastructure PolicyJanuary 2736January 2736passed

Random fact: "Spamming", or the indiscriminate posting of unsolicited messages, is not allowed.

Random quote: "Morality is simply the attitude we adopt towards people whom we personally dislike." - Oscar Wilde

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51