Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5495
Next month in: 00:33:45
Server time: 11:26:14, June 07, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


House of Argentus (HoA)[?]

This page contains information about the House of Argentus (HoA).

This party is inactive.

Details

User[?]: Zor

Nation[?]: Dovriges Republik (Davostag)

Seats[?] in Riksdag (National Diet)[?]: 0

Color[?]:

 

Description[?]:

For making a more democratic region, Vida Argentus is the first of the Argentus house.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiesconvinced small governmentexcellentperfect
Marketmoderate laissez-faireexcellentperfect
Militaryconvinced militaristmoderateperfect
Moralityprogressive-leaninghighperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
September 332933,70064,868,5760.05+0.0507500.00+0
November 332925,01465,020,9030.04-0.0107500.00+0
February 333032,51660,869,7260.05+0.0107500.00+0
November 333045,21459,551,7130.08+0.0207500.00+0
May 333354,22863,975,6010.08+0.0107500.00+0
October 33358,892,91858,792,63615.13+15.0411675015.47+116
December 33396,599,80853,772,31512.27-2.859475012.53-22
August 33425,326,53148,874,64210.90-1.388475011.20-10
March 33438,699,39460,276,48114.43+3.5311075014.67+26
August 33489,290,44158,292,39015.94+1.5111975015.87+9
August 33548,182,36245,577,98317.95+2.0113775018.27+18
May 33554,460,45746,650,8629.56-8.39697509.20-68
March 336114,097,52840,937,67934.44+24.8829175038.80+222
September 336215,127,37549,332,13030.66-3.7724675032.80-45
September 336817,181,14950,065,18434.32+3.6527475036.53+28
January 337215,070,95950,910,65929.60-4.719430031.33-180
January 337512,864,25647,797,65226.91-2.698130027.00-13
January 337817,187,02845,957,50037.40+10.4812230040.67+41
January 33808,686,89022,044,71639.41+2.0116330054.33+41
January 33838,630,21820,075,99942.99+3.5816630055.33+3
February 33858,515,49022,849,59737.27-5.7213030043.33-36

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the House of Argentus (HoA).

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385

BillCreatedVoting startedVoteBill StatusResult
Citizenship Reform ActApril 2722April 2722passed
Religious ReformsApril 2722April 2722passed
Adultery Reform ActApril 2722April 2722passed
Civil Liberties ReformApril 2722April 2722passed
Criminal Justice Reforms ActApril 2722April 2722passed
Civil Liberties Restoration ActApril 2722April 2722passed
Satan Demands! Act 016March 2721March 2721passed
Civil Liberties Protection MeasureJanuary 2721May 2721defeated
Pension and Welfare ProvisionJanuary 2721May 2721passed
Eminnent Domain rights ActJanuary 2721May 2721defeated
Tax Reform PackageNovember 2720January 2721defeated
Food Sales ActNovember 2720January 2721passed
Food Standards BillNovember 2720January 2721passed
Cosmetics Testing ReformNovember 2720January 2721defeated
Medicinal Reforms ActNovember 2720November 2720defeated
Endangered Species Protection measureNovember 2720November 2720defeated
Animal ActNovember 2720November 2720defeated
Bio-Chemical Weapons ReformMay 2720July 2720passed
Dis-establishment BillMay 2720July 2720passed
Church-State Seperation ActMay 2720May 2720passed

Random fact: "Doxxing", or the publishing of personally identifiable information about another player without permission, is forbidden.

Random quote: "Conservative, n: A statesman who is enamored of existing evils, as distinguished from the Liberal who wishes to replace them with others." - Ambrose Bierce

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51