Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5495
Next month in: 03:29:28
Server time: 04:30:31, June 07, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Golden Party (UPDD)[?]

This page contains information about the Golden Party (UPDD).

This party is inactive.

Details

User[?]: justinmmm777

Nation[?]: Dorvische Republik (Dorvik)

Seats[?] in Staatsrat (State Council)[?]: 0

Color[?]:

 

Description[?]:

Here at the Golden Party we would like to create a nation where one can do as they wish as long as it does not effect someone else's life.

Views on Centralization-

The Federal Government should have most power with little power to the Districts. We should give limited powers to these districts in order to keep a similar system of education, health care, and others.

Civil Rights-

We believe in freewill unless it directly affects someone else. We don't believe in the right to bear arms though.

Ecology-

We like to be environmentalist but not to an extent that it takes over peoples lives.

Foreign Relations-

We would like to be an internationalist and create treaties for the good of people in every nation.

Government Responsibilities-

We would like to be a small government but not too extreme on it. People still need certain rules.

Market-

We only like to a regulator at last resort. Perhaps when a company is close to bankruptcy we will then subsidize them.

Military-

We want to defend, not attack. We should only use armies in defense situations.



Party Chairmen:

Fred Franou: 2699-2720
George Botland: 2720-2728
Mark Turnmen: 2728-2738
David Bricket: 2738-2747
John Loomis: 2747-2755
Andrew Evestan: 2755-2760
Riley Durham: 2760-2768
Peter Derd: 2768-Present

Party Headquarters -- Lissenfield, Mothar, Free Republic of Dorvik

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsrestrictive-leaninglimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsinternationalist-leaninglimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate regulatorlimitedperfect
Militarymilitarist-leaninglimitedperfect
Moralitymoderate progressivelimitedperfect
Religionsecular-leaningclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
September 270214,136,230161,559,4198.75+8.75384258.94+38
January 270316,777,769162,477,12510.33+1.584542510.59+7
January 270614,249,822163,588,0088.71-1.62384258.94-7
January 270924,854,685164,248,76815.13+6.426542515.29+27
January 271219,614,581161,498,82712.15-2.995242512.24-13
January 271525,463,184163,880,40015.54+3.396542515.29+13
January 271820,404,303169,407,64712.04-3.495042511.76-15
January 272117,537,117173,090,64810.13-1.914442510.35-6
September 272117,906,921170,877,76810.48+0.354542510.59+1
September 272417,340,067169,278,73610.24-0.244342510.12-2
September 272719,076,964173,376,20311.00+0.768375011.07+40
September 273019,214,931178,234,78810.78-0.228075010.67-3
September 273320,292,415181,007,55611.21+0.438575011.33+5
September 273616,095,366184,101,9638.74-2.47657508.67-20
August 273815,116,131179,807,0018.41-0.34627508.27-3
August 27418,036,256180,269,5524.46-3.95307504.00-32
August 27447,725,039189,436,2974.08-0.38297503.87-1
August 27478,390,875190,970,5774.39+0.32317504.13+2
August 27508,808,112189,621,4374.65+0.25337504.40+2
August 275311,081,893188,010,6585.89+1.25447505.87+11
July 275514,272,347185,835,7317.68+1.79587507.73+14
June 275727,727,157185,144,42714.98+7.3011375015.07+55
June 276026,768,515172,026,60215.56+0.5812275016.27+9
June 276343,321,145178,334,38224.29+8.7318675024.80+64
June 276631,795,834178,590,06717.80-6.4913975018.53-47
June 276931,054,050178,371,23917.41-0.3913575018.00-4
June 277228,002,300205,030,95213.66-3.7510175013.47-34
June 277528,843,011194,128,56014.86+1.2011075014.67+9
January 277923,749,551208,444,27211.39-3.468375011.07-27
January 278226,772,722210,084,48612.74+1.359475012.53+11
January 278528,229,021197,980,42514.26+1.5110675014.13+12
January 278825,222,551205,579,34712.27-1.999275012.27-14

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Golden Party (UPDD).

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681

BillCreatedVoting startedVoteBill StatusResult
The Child Labour Abolition ActMay 4820November 4820defeated
Law on Rent RegulationNovember 4818November 4818passed
Law on Contientious ObjectionNovember 4818November 4818passed
RP: Amendment to the State Defense Law (4816 Amendment)October 4816December 4816passed
Call for early elections, October 4816October 4816October 4816passed
Law on Foreign AidNovember 4815November 4815passed
Government policy towards giving aid to foreign countriesJune 4815June 4815defeated
Government policy concerning granting nationality (national of this state without implication of having citizenship rights).December 4814December 4814passed
Structure of the executive branch.December 4814December 4814defeated
RP: Amendment to the State Defense Law (4813 Amendment)November 4813November 4813passed
The King and Kaiser are dead, Long live the King and Kaiser! (Coronation of Wilhelm XIII)December 4812December 4812passed
Call for early elections, November 4812November 4812November 4812passed
Government's position on paramilitaries.January 4812January 4812defeated
Government policy concerning religions.November 4811November 4811defeated
Homeless shelters and reintegration projectsNovember 4811November 4811defeated
Eminent Domain.December 4810December 4810defeated
Government policy on airports.December 4810December 4810defeated
National policy regarding the desecration of the national flag.February 4810February 4810defeated
The government's policy with respect to adultery.February 4810February 4810defeated
The government's policy concerning the use of chemical and biological weaponry in warfareMay 4809May 4809defeated

Random fact: Cultural Protocols should generally be reflective of RP conducted within the nation and should not significantly alter or modify the ethnic, religious or linguistic composition without considerable and reasonable role-play or other justification.

Random quote: "When women are depressed, they either eat or go shopping. Men invade another country. It's a whole different way of thinking." - Elaine Boosler

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51