Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: December 5490
Next month in: 03:40:57
Server time: 12:19:02, May 29, 2024 CET
Currently online (1): EidDorvik | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Freedom Party of Wantuni[?]

This page contains information about the Freedom Party of Wantuni.

This party is inactive.

Details

User[?]: true_fighter

Nation[?]: Kalopikí Dimokratía (Kalopia)

Seats[?] in Vouli (Κοινοβούλιο)[?]: 0

Color[?]:

 

Description[?]:

For Freedom and Independence of Wantuni People

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate permissivehighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistlimitedperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaningmoderateperfect
Militarymoderate militaristlimitedperfect
Moralityconvinced progressivemoderateperfect
Religionconvinced secularlimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 2117000.00+0.0001000.00+0
March 21176,707,84116,525,64340.59+40.594110041.00+41
September 21172,346,17121,685,10910.82-29.771010010.00-31
September 21215,604,27835,293,79115.88+5.061410014.00+4

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Freedom Party of Wantuni.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350

BillCreatedVoting startedVoteBill StatusResult
Freedom of ExpressionMarch 2640January 2641defeated
Polygamy ActFebruary 2640January 2641defeated
Abortion ActJanuary 2633January 2633passed
Increase Age of AdulthoodAugust 2631January 2632defeated
Civil Defence ActAugust 2631August 2631defeated
Budget proposal of July 2628July 2628July 2628passed
Budget proposal of December 2627December 2627May 2628passed
Budget proposal of June 2627June 2627August 2627passed
Income tax proposal of June 2627June 2627August 2627passed
Abortion Devolution ActJune 2627June 2627passed
Religious Taxation ActJune 2625June 2625passed
Corporate Tax Cut ActJanuary 2625January 2625passed
Luxury Goods Tax ActJanuary 2625January 2625defeated
Obscene Acts Devolution ActFebruary 2624February 2624passed
Eminent Domain Adjustment ActFebruary 2624February 2624passed
Letter Violation Adjustment ActFebruary 2624February 2624defeated
Smoking DevolutionFebruary 2624February 2624passed
Forest Conservation BillDecember 2622November 2624defeated
Drug Use RegulationDecember 2622November 2623defeated
New National Sport: Chariot RacingAugust 2622February 2624passed

Random fact: It is possible for a player to transfer ownership of a character or a royal house to another player. This should be done in a public way, such as on the Character Transfers thread, so that if a dispute arises in the future, Moderation can be pointed towards evidence of the transfer.

Random quote: "Terror is only justice: prompt, severe and inflexible; it is then an emanation of virtue; it is less a distinct principle than a natural consequence of the general principle of democracy, applied to the most pressing wants of the country." - Maximilien Robespierre

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52