Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: March 5494
Next month in: 02:09:35
Server time: 01:50:24, June 05, 2024 CET
Currently online (1): Papa_Zulan | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


House Stafford[?]

This page contains information about the House Stafford.

This party is inactive.

Details

User[?]: lamestain

Nation[?]: Tælmörksríki / Kingdom of Telamon (Telamon)

Seats[?] in Landsthingi (National Assembly)[?]: 0

Color[?]:

 

Description[?]:

House of Stafford

Ealdread Claudius Stafford
Born 3267
King of the Tela, the Likaton and the First Men
Duke of Telapolis
Lord of the Five Kingdoms
Protecter of the Realm

http://particracy.wikia.com/wiki/House_Stafford

Centralization - Unitarist
Civil Rights - Permissive
Foreign Policy - Internationalist
Gov't Role - Big Government

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsconvinced permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistlimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate laissez-fairelimitedperfect
Militaryconvinced militaristclose to noneperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 32682,346,95160,517,6193.88+3.88246004.00+24
April 327210,460,92355,567,95118.83+14.9511760019.50+93
June 327510,295,97755,972,37918.39-0.4311160018.50-6
June 327615,793,33454,709,57928.87+10.4717860029.67+67
December 327910,894,97057,823,85718.84-10.0311560019.17-63
August 328110,123,31050,869,06219.90+1.0612160020.17+6
February 328510,329,32857,759,78217.88-2.0210960018.17-12
December 328913,460,06159,621,82522.58+4.6913460022.33+25
June 329312,629,33958,793,73621.48-1.0913060021.67-4
February 329612,794,19653,607,34423.87+2.3914660024.33+16
August 32999,093,65048,965,66018.57-5.3011160018.50-35
November 330119,743,04859,841,73132.99+14.4219960033.17+88
May 330528,487,22860,077,31147.42+14.4328660047.67+87
November 330835,603,78964,134,75755.51+8.1033460055.67+48
July 331831,849,29952,988,63360.11+4.5934660157.57+12
January 332214,228,40457,014,53824.96-35.1514560124.13-201
July 332520,541,50556,871,93636.12+11.1621060134.94+65
January 332920,748,39052,715,61739.36+3.2424960141.43+39

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the House Stafford.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560

BillCreatedVoting startedVoteBill StatusResult
Eminent Domain Devolution ActMarch 2864March 2864defeated
Eminent Domain Compensation ActMarch 2864March 2864defeated
Energy Generation Allowance ActMarch 2864March 2864passed
Highway Construction Privatization ActMarch 2864March 2864defeated
Post Office Privatization ActMarch 2864March 2864defeated
Public Works Initiative Devolution ActMarch 2864March 2864defeated
Renewable Energy Devolution ActMarch 2864March 2864defeated
Welfare Devolution ActMarch 2864March 2864passed
Health Care Privatization ActMarch 2864March 2864defeated
TOC Privatization ActMarch 2864March 2864defeated
Cabinet Proposal of September 2863September 2863September 2863defeated
COM Election Reform (again)March 2863March 2863defeated
Salad BillMarch 2863March 2863defeated
Stop War BillMarch 2863March 2863defeated
COM Constitution ReformOctober 2862October 2862defeated
COM Treaty Withdrawls AgainOctober 2862October 2862defeated
COM Treaty Withdrawl ReduxOctober 2862October 2862passed
Religious School Reform ActMay 2862November 2862defeated
DCDR.221.3.2862: Call for Early ElectionsMarch 2862March 2862passed
Peoples Rights NOT!!!January 2862January 2862defeated

Random fact: Role-play is most enjoyable and successful when there is good communication and friendly relations between all players involved.

Random quote: "I refuse to accept the view that mankind is so tragically bound to the starless midnight of racism and war that the bright daybreak of peace and brotherhood can never become a reality.... I believe that unarmed truth and unconditional love will have the final word." - Martin Luther King, Jr.

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51