Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5573
Next month in: 01:31:47
Server time: 22:28:12, November 24, 2024 CET
Currently online (1): Jacob Noakes | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Liberal-Conservative Progressive Party[?]

This page contains information about the Liberal-Conservative Progressive Party.

This party is inactive.

Details

User[?]: William Quinn

Nation[?]: Dovriges Republik (Davostag)

Seats[?] in Riksdag (National Diet)[?]: 0

Color[?]:

 

Description[?]:

"Dedicated to getting the government out of your Face, out of your Wallet, and out of your Life."

Th L-C Progressives are a classical liberal party, activly fighting to get the government out of the average mans life. We belive in personal responsiblity, and a free market. We also fight for greater devolution of powers to the provinces

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsmoderate permissivelimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsinternationalist-leaninglimitedperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate laissez-fairelimitedperfect
Militarypacifist-leaninglimitedperfect
Moralityconservative-leaningclose to noneperfect
Religionmoderate religiouslimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 21281,328,98824,938,4595.33+5.33255005.00+25
July 21311,836,10124,352,4107.54+2.21375007.40+12
July 21344,127,02422,424,13018.40+10.869250018.40+55
July 21376,995,72826,110,70726.79+8.3913550027.00+43

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Liberal-Conservative Progressive Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385

BillCreatedVoting startedVoteBill StatusResult
Death Penalty ActApril 2417September 2417defeated
Foreign Investment ActApril 2417September 2417passed
Missionary Freedom ActApril 2417September 2417defeated
Eminent Domain ActApril 2417September 2417passed
Military Orientation ActApril 2417September 2417passed
Civil Marriage ActApril 2417September 2417passed
Fireworks ActApril 2417September 2417defeated
Retirement Age ReductionApril 2417September 2417defeated
Childbirth Freedom ActApril 2417September 2417defeated
Unbiased Media ActMarch 2417August 2417defeated
UCD - Cloning 2416October 2416August 2417defeated
UCD - Nueva Politica de Defensa NacionalOctober 2416October 2416passed
Freedom of Movement ActSeptember 2416August 2417defeated
Income tax proposal of September 2416September 2416September 2416passed
Corporation and Luxury Taxation BillAugust 2416October 2416passed
Reproductive HealthAugust 2416August 2416passed
Cabinet Proposal of May 2415May 2415May 2415passed
Citizenship BillApril 2415April 2415defeated
Military ReformOctober 2414March 2415passed
Forestry and Parks ActDecember 2413December 2413passed

Random fact: The forum contains a lot of useful information, it has updates to the game, role playing between nations, news and discussion. http://forum.particracy.net/

Random quote: "Communism, like any other revealed religion, is largely made up of prophecies." - H. L. Mencken

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51