Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5575
Next month in: 00:37:35
Server time: 15:22:24, November 28, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


✊Independent Workers Party[?]

This page contains information about the ✊Independent Workers Party.

This party is inactive.

Details

User[?]: Independent Humanitarian Party

Nation[?]: Royaume Uni de Lourenne (Lourenne)

Seats[?] in Assemblée Populaire (Popular Assembly)[?]: 0

Color[?]:

 

Description[?]:

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningexcellentperfect
Civil Rightsmoderate permissiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistmoderateperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketmoderate laissez-fairehighperfect
Militaryconvinced militaristhighperfect
Moralityconservative-leaningmoderateperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
October 419224,775,02229,758,04683.25+83.2520225080.80+202

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the ✊Independent Workers Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323

BillCreatedVoting startedVoteBill StatusResult
PR - 01 Defense Industries ActMarch 4573August 4573defeated
CNCU-42: Civil Liberties Reform ActJanuary 4573October 4573passed
CNCU-41: Eminent Domain ActJanuary 4573October 4573passed
CNCU-40: Religion Administration ActOctober 4572July 4573passed
CNCU-39: Local Authorities Act (4572)March 4572March 4572passed
CNCU-38: Local Authorities ActSeptember 4571September 4571passed
CNCU-37: Nuclear and Biochemical Weapons Ban ActSeptember 4571September 4571passed
Cabinet Proposal of June 4570June 4570June 4570defeated
RB-03 Lourenne Economy De-regulation (Reform) ActJune 4570June 4570defeated
RB-02 International Aid (Amendment) ActJune 4570June 4570defeated
RB-01 Fishing Deregulation ActJune 4570June 4570passed
CNCU-36 Sales Tax Amendment ActMay 4569May 4569defeated
CNCU-36March 4569March 4569passed
CNCU-34: Greater Valois Metropolitan Authority ActMarch 4569March 4569passed
CNCU-35 Animal Testing Amendment ActFebruary 4569April 4569defeated
CNCU-33 Corporate Fairness ActNovember 4568November 4568defeated
CNCU-32 Donation of Organs Amendment ActNovember 4568November 4568passed
CNCU-31: Nuclear Energy Ban ActSeptember 4568September 4568passed
CNCU-30: Ecology Management ActSeptember 4568September 4568passed
CNCU-29: Immigration and Aid Readjustment ActSeptember 4568September 4568passed

Random fact: Moderation will not approve a Cultural Protocol request within the first 48 hours of it being requested. This is in order to give other players a chance to query the proposed changes, if they wish to do so. Moderation may be approached for advice on a proposed change, but any advice proffered should always be understood under the provisio that no final decision will be made until at least 48 hours after the request has been formally submitted for approval.

Random quote: "Erotic politicians, that's what we are. We're interested in anything about revolt, disorder, chaos and activity that appears to have no meaning." Jim Morrison

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51