Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5487
Next month in: 03:33:56
Server time: 04:26:03, May 23, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Maroon Party[?]

This page contains information about the Maroon Party.

This party is inactive.

Details

User[?]: Maroon

Nation[?]: Bürgerrepublik Dorvik (Dorvik)

Seats[?] in Staatsrat (State Council)[?]: 0

Color[?]:

 

Description[?]:

We a party dedicated to sensible, moderate, and restrained government. Our political views are best described as moderately libertarian.

Our Platform:
- We believe that, any issue that can be left to local government and affects no other localities, should be left to local government simply because the national government can potentially do much more harm than any local government and only a little more good; the most local government is the individual, a government of one.
- We believe that an individual's civil rights and liberties are necessary checks on the government; and that only in the most extreme circumstances can the ends justify the means.
- We believe that excessive pollution is a prime example of market failure and are willing to step in to correct it, but we also believe that environmental concerns must be balanced against concerns of economic growth and freedom, and that, when possible, market-based incentives such as property rights and the auctioning of pollution rights are the most desirable solutions.
- We believe that it is not our role to dictate the domestic policies of other nations, but we do support a loose immigration policy and genuine free trade.
- We believe that if a problem can be solved through the voluntary interaction of the private sector, it is best solved there, and that the role of the coercive government should be limited as a last resort, to areas that the private sector is inadequate, priding ourselves as a genuine party of small government.
- We believe that, nine times out of ten, the market is the most efficient mechanism for allocating goods, and that the role of the government in the economy is to provision public goods, ensure a framework of honest trade, and correct for market externalities.
- We believe in a well-funded, but defense-oriented, military. We oppose conscription under any conditions, and believe in generous pay for soldiers and pensions and benefits for veterans.
- We believe that morality is an issue for the individual conscience, and that the role of the government is to provide a framework in which all individuals are allowed to live according to their own values, in short, a person's right to swing his arm only ends at his neighbor's nose.
- We believe that religion has a positive role to play in society when it is separate from the corrupting influence of politics, and thus support a loose separation of church and state.
- We remain committed to the principles of republicanism and the rule of law, in order to maximize individual rights as well as the ability of people to participate in the civic sphere.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsconvinced permissivemoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsinternationalist-leaninglimitedperfect
Government Responsibilitiesconvinced small governmentmoderateperfect
Marketregulator-leaningmoderateperfect
Militarypacifist-leaninglimitedperfect
Moralityconvinced progressivemoderateperfect
Religionconvinced secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 20802,353,28416,861,38713.96+13.961510015.00+15
August 20831,963,20816,706,12911.75-2.211310013.00-2
August 20861,577,97316,073,5209.82-1.931110011.00-2
August 20892,564,29616,140,44515.89+6.071810018.00+7
August 20912,721,22315,623,23517.42+1.531810018.00+0
August 20933,736,02418,751,34019.92+2.512110021.00+3
January 20962,590,90121,395,28012.11-7.812720013.50+6
January 20992,627,58720,906,73912.57+0.462720013.50+0
November 21002,707,00719,747,91313.71+1.142920014.50+2
November 21032,296,85316,459,01313.95+0.252920014.50+0
November 21062,291,91714,050,04516.31+2.363420017.00+5
November 21095,208,79222,683,57822.96+6.654720023.50+13
November 21123,800,09319,262,55619.73-3.234120020.50-6
November 21154,711,78320,127,43323.41+3.684820024.00+7
November 21182,628,83322,671,38311.60-11.812620013.00-22
November 21213,174,63520,792,59215.27+3.673120015.50+5
November 2124360,30321,123,9231.71-13.5622001.00-29
November 21273,628,07122,024,73916.47+14.773320016.50+31
November 21304,131,54321,045,11219.63+3.164020020.00+7
November 21333,294,07922,701,46314.51-5.123020015.00-10
June 21353,788,32523,158,58216.36+1.853220016.00+2
September 21363,767,23824,132,47815.61-0.753220016.00+0
September 21393,067,54123,871,61412.85-2.762520012.50-7
May 21422,660,09026,490,15610.04-2.812020010.00-5
November 21452,712,73022,324,33712.15+2.112520012.50+5
November 21481,847,13924,918,3907.41-4.74142007.00-11
November 21511,713,56325,568,1366.70-0.71122006.00-2
May 21552,173,91625,817,9108.42+1.72162008.00+4
May 21582,747,27429,968,0359.17+0.75182009.00+2
June 21582,821,03629,793,6389.47+0.30182009.00+0
July 21582,478,55729,894,1878.29-1.18162008.00-2
July 21612,550,25630,816,6028.28-0.02162008.00+0
October 21643,052,63130,312,94910.07+1.79192009.50+3
October 21673,301,00930,104,94910.97+0.892220011.00+3
December 21683,225,90229,820,90910.82-0.152220011.00+0
December 21713,060,92828,049,62910.91+0.092120010.50-1
December 21743,138,05027,850,57411.27+0.352320011.50+2
December 21773,965,70827,756,07914.29+3.022920014.50+6
December 21804,017,34128,347,08114.17-0.122920014.50+0
December 21835,262,91630,166,68817.45+3.273420017.00+5
December 21864,784,33332,965,29514.51-2.932920014.50-5
January 21905,161,47534,804,60714.83+0.323020015.00+1
January 21935,275,24335,019,07415.06+0.233120015.50+1
January 21965,176,32535,299,89014.66-0.402820014.00-3
January 21994,711,67731,027,48115.19+0.523020015.00+2
January 22024,468,00832,634,33313.69-1.492820014.00-2
May 22044,615,65133,000,62513.99+0.302719913.57-1
May 22074,223,40832,780,87912.88-1.102619913.07-1
April 22084,783,96033,742,52914.18+1.292919914.57+3
April 22113,761,79635,545,84510.58-3.592219911.06-7
April 22143,857,20836,991,43810.43-0.16191999.55-3
April 22174,216,62236,819,44611.45+1.022219911.06+3
April 22204,374,71736,484,45411.99+0.542419912.06+2
April 22234,196,67536,759,71111.42-0.572219911.06-2
May 22245,215,50035,578,37714.66+3.242919914.57+7
May 22275,055,46435,789,82414.13-0.532719913.57-2
May 22305,858,07138,171,34515.35+1.223119915.58+4
December 22315,958,27638,410,09315.51+0.173219916.08+1
December 22345,783,56739,221,52714.75-0.772919914.57-3
December 22375,357,09637,211,21414.40-0.352919914.57+0
December 22404,891,45137,668,70212.99-1.412619913.07-3
December 22434,858,55140,074,83512.12-0.862219911.06-4
December 22466,576,75642,415,75115.51+3.383019915.08+8
December 22497,173,81343,746,78816.40+0.893219916.08+2
December 22527,137,41143,675,88216.34-0.063119915.58-1
December 22555,621,61741,173,84113.65-2.692619913.07-5
December 22585,396,37440,981,95713.17-0.492519912.56-1

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Maroon Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680

BillCreatedVoting startedVoteBill StatusResult
Domestic Animal RegistrationJuly 3050August 3050defeated
Terms of extraditionApril 3050June 3050defeated
Death Penalty ActApril 3050June 3050passed
Administrative ActDecember 3049December 3049defeated
Cabinet Proposal of November 3049November 3049November 3049passed
Eminent Domain ActNovember 3049November 3049passed
Wild Animals ActNovember 3049November 3049passed
Waste DisposalNovember 3049November 3049passed
Hunting RegulationNovember 3049November 3049passed
Exotic Animals ActNovember 3049November 3049passed
Gated CommunitiesMay 3049October 3049defeated
Energy RegulationsMay 3049October 3049passed
Child VaccinesMay 3049October 3049defeated
Police Force and Military ActMay 3049October 3049defeated
Prisoners of War ActMay 3049October 3049passed
Nuclear WarefareMay 3049October 3049passed
Budget proposal of March 3049March 3049March 3049passed
Farm Size ActJanuary 3049January 3049defeated
Pesticides ActJanuary 3049January 3049defeated
Refugee ActDecember 3048December 3048passed

Random fact: Never use the same password as a friend. If two or more active accounts use the same password, they will be inactivated.

Random quote: "In America today, you can murder land for private profit. You can leave the corpse for all to see, and nobody calls the cops." - Paul Brooks

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51