Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: May 5492
Next month in: 03:34:02
Server time: 08:25:57, June 01, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


National Independence Movement[?]

This page contains information about the National Independence Movement.

This party is inactive.

Details

User[?]: Dick Tator

Nation[?]: Yingdala Datong (Yingdala)

Seats[?] in 大会 (Grand Assembly)[?]: 0

Color[?]:

 

Description[?]:

We take a more nationalistic approach in governance. Promoting issues relative to the state to raise the quality of living of the members of the state. We stand for quick action and decision making, as to minimize public costs of maintaining lenthy parlimenary debates. Increased power is invested in the head of state and government. Isuue involving soveriegnity and independence of the state are heavily supported. "We must stand firm and independent"

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninglimitedperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesbig government-leaninghighperfect
Marketconvinced regulatorhighperfect
Militarymoderate militaristlimitedperfect
Moralityprogressive-leaningmoderateperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 229458,27661,779,9410.09+0.0907500.00+0
February 23008,358,06162,463,31813.38+13.299975013.20+99
December 23038,968,15864,852,42513.83+0.4510475013.87+5
October 23059,869,33863,137,09415.63+1.8011675015.47+12
April 230910,016,46163,546,39215.76+0.1311675015.47+0
October 23128,733,23063,900,26113.67-2.1010275013.60-14
April 23167,512,39465,689,85911.44-2.238575011.33-17
October 23198,819,09059,260,59114.88+3.4511275014.93+27

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the National Independence Movement.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418

BillCreatedVoting startedVoteBill StatusResult
Wartime Use of Weapons of Mass Destruction ActOctober 2093October 2093passed
Immigration Act 2093August 2093August 2093passed
Act to create a Capital CityJuly 2093July 2093defeated
Ministers of Religion Remuneration ActJuly 2093July 2093passed
Call for early elections, January 2093January 2093January 2093defeated
Weapons of Mass Destruction Abolition ActSeptember 2092September 2092defeated
Space Defense InitiativeJanuary 2092January 2092defeated
Corporate Tax IncreaseDecember 2091December 2091defeated
Environmental ActAugust 2091August 2091passed
Public Smoking ActAugust 2091August 2091passed
The Flag (with the motto added)July 2090July 2090passed
National Anthem ActMay 2090May 2090passed
Education ActOctober 2089October 2089passed
Eminent Domain Compensation ActOctober 2089October 2089passed
Justice ReformJune 2089June 2089defeated
The Flag (With our Motto Added)January 2089January 2089defeated
Workers' Rights ActNovember 2088November 2088passed
Public Broadcasting and Library ActNovember 2088November 2088passed
Environment ActOctober 2086October 2086passed
Food Safety ActOctober 2086October 2086passed

Random fact: Players are expected to behave in a courteous, co-operative manner and make a reasonable effort to act with the consent of all players involved, even where the rules do not make consent strictly necessary. In particular, players have a responsibility to take reasonable care that other players are not misinformed either about the role-play or the Game Rules.

Random quote: "Stupid people are ruining America." - Herman Cain

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51