Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5492
Next month in: 02:57:44
Server time: 05:02:15, June 02, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Conservative Party[?]

This page contains information about the Conservative Party.

This party is inactive.

Details

User[?]: Vlaams

Nation[?]: Poblacht na Choiarlabhan (Kirlawa)

Seats[?] in Dáil Choiarlabhan[?]: 0

Color[?]:

 

Description[?]:

=Founding=

The Freedom Party was founded in October 3556 by several former members of the Democratic Freedom Party, including Lars Anderson who had been a member of the General Assembly for the DFM until he lost his seat in the 3556 general election. Other founding members included businessmen, academics, economists, farmers and students associated with pro-free market and conservative groups.

The Freedom Party aims to provide representation to those who believe in a free market economy along with a tough stance on defence and law and order. The Party aims to provide better representation to Middle Class and Agricultural communities in Kirlawa. The Party dislikes the overwhelming leftist outlook of the General Assembly and aims to bring about a centre-right realignment.

Lars Anderson was selected as the party's first Presidential candidate in Jan 3559, although the party are more focused on an electoral breakthrough in the national assembly.

=Cabinet Positions=

==May 3560 -==

Head of Government - Lars Anderson
Internal Affairs - Samara Jacohvs
Defence - Thomas Mooney
Food and Agriculture - Henry Wallace
Trade and Industry - Seamus McCraig

== April 3572==

The FP entered government with the Greens.

Head of Government - Lars Anderson
Internal Affairs - Samara Jacohvs
Defence - Thomas Mooney
Infrastructure and Transport – Mhairi Vaughnessen
Education and Culture – Tanya Tait
Food and Agriculture - Henry Wallace
Trade and Industry - Seamus McCraig


== Dec 3575 - Jan 3577 ==

The FP entered government with the Democratic Freedom Party.

Head of Government - Lars Anderson
Internal Affairs - Samara Jacohvs
Justice – Patrick Roberts
Health and Social Services – Tanya Tait
Food and Agriculture - Henry Wallace
Environment and Tourism - Mhairi Vaughnessen

Jan 3581 -

The CP came to government for the first time in alliance with the leftist parties.

Ministry of Foreign Affairs - Tanya.Tait Ministry of Infrastructure and Transport - Patrick Roberts
Ministry of Food and Agriculture - Mhairi Vaughnessen



=Key Figures=

==Lars Anderson==

Lars Anderson (b. 3507) is credited as the founder and first leader of the Freedom Party. Anderson had been a policeman in Nuchtmark until he retired at the age of 45. He had earlier joined the refounded Democratic freedom Party in 3542 and was elected to office in 3549 as a National Assemblyman.

Anderson became a leading figure within the libertarian wing of the party, although was strongly dissilusioned with the leadership of the party. As a result he was demoted down the party list for the 3556 election and in the process lost his seat.

Anderson took the opportunity to found a new political movement and was a key memebr of the foundation of the Freedom Party, becoming its first leader and Presidential candidate in 3559 where he came within 1.1% of victory.

Anderson became the Prime Minister between 3560 and 3577, losing his position after a change of government at the age of 70. By the summer of 3578 his continued position as leader had become untenable, and along with much of the senior leadership Lars Anderson supported the motion to disband the Freedom Party.

Lars Anderson has never married although he has three children with his partner. Anderson is a lifelong athiest, although believes in freedom of belief. Socially liberal he believes in small government , combined with a robust defence policy and secure borders.

=Election Results=

==3559==

The 3559 general and Presidential elections witnessed a massive breakthrough for the Freedom Party. Election specialists have given three keys reasons. Firstly the dynamic appeal of a new party that specifically appealed to groups in society that felt unrepresented (farmers, middle classes), secondly the successful influence of the Freedom Party that had led to the passage of legislation demonstrating that the Freedom Party was the party of change and thirdly a breakdown of confidence in the older parties that led to a complete failure to see the Freedom Party as a threat.

The Freedom Party surged to gain 177 National Assembly on nearly 25% of the vote, and Lars Anderson took 49.5% of the vote of the second round of Presidential elections having narrowly squeezed out the DFM and Green Party in the first round. The party took over half the vote in Nuchtmark and topped the poll in Dirguzia.

However this astounding success leaves the Freedom Party open to potential issues. Only 30 of their new assemblymen had previously served in the National Assembly (with other parties), leaving a huge number of inexperienced politicians who may have only seen elected office at the regional or even local level previously. The number of new members is likely to lead to factionalism that could split the party. However under the strong leadership of Anderson the party is likely to retain its new image and activity and may well hold onto much of its new support.

==3563==

Total mixed results for the Freedom Party. The Party was effectively trashed in Dirguzia and Nuchtmark. In these two regions they 124 Assembly Members before the election and this fell to just 26. The lost of 62 members in Nuchtmark severely weakened Lars Andersons positions within the party.

Despite these catastrophic losses the Freedom Party actually made solid gains in Dirlana, Merkan and Uwakah, increasing their representation from 53 to 93 and masking the dreadful performance in Dirguzia and Nuchtmark. The dramatic losses are explained by the defection of middle class liberal voters back to the Greens and the lost of anti-establishment votes as the Freedom Party led a new coalition government. Gains are explained by successful appeals to middle class and agricultural areas that hadn’t been targeted by the Freedom Party in 3559.

Talk of a leadership challenge in 3564 have gone unheeded and Lars Anderson seems secure in his position as it tries to prevent the Freedom Party turning into a populist right-wing organisation and maintain it as a centrist economically liberal party.

= 3578 Disbanding and Formation of the Conservative Party =

After a poor showing in the 3577 general election in which the party declined to 13% of the vote, Right-Wing ministers and leaders within the party, including the party’s youth wing, endorsed a socially conservative platform and challenged the leader of the Party Lars Anderson to implement it. Anderson retained enough support at the party conference to defeat the platform, however after consultation with centrist and socially liberal senior figures within the party it was decided that the Freedom Party could no longer exist in its present form and that the left-wing of the party was invited to join the DFP and the Greens. The socially conservative rump, under the direction of former cabinet ministers Patrick Roberts, Tanya Tait and Mhairi Vaughnessen took on the main apparatus of the Freedom Party, forming the Conservative Party in Nov 3578.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristlimitedperfect
Civil Rightsrestrictive-leaninghighperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate isolationisthighperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaningmoderateperfect
Militaryconvinced militaristmoderateperfect
Moralitymoderate conservativemoderateperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 355916,220,05465,438,47024.79+24.7917771724.69+177
January 356310,819,32865,216,89916.59-8.2011971716.60-58
July 356615,335,49565,637,24823.36+6.7716771723.29+48
January 357016,716,19060,906,33627.45+4.0819271726.78+25
July 357314,072,94463,152,57122.28-5.1615971722.18-33
January 35778,481,09963,131,93413.43-8.859671713.39-63
July 35808,453,08365,838,20912.84-0.599371712.97-3
January 358412,314,29561,758,00219.94+7.1014371719.94+50
July 358710,713,84760,280,91417.77-2.1712671717.57-17
January 35917,349,69858,971,54412.46-5.318871712.27-38
July 35944,610,09656,507,2668.16-4.30587178.09-30
January 35989,258,30164,270,21514.41+6.2510471714.50+46
July 36016,516,27358,463,31511.15-3.267871710.88-26
January 36057,519,40061,158,37012.29+1.158671711.99+8

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Conservative Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524

BillCreatedVoting startedVoteBill StatusResult
Open Kirlawa BillJanuary 2315October 2315passed
Family Aid BillJanuary 2315October 2315defeated
Cabinet Proposal of December 2314December 2314December 2314passed
Trade of Arms ActAugust 2314January 2316passed
Practice of Religion in SchoolsMarch 2314January 2316defeated
Call for early elections, July 2314March 2314July 2314passed
KPF98-16 Seperation of Church and State BillNovember 2313November 2313passed
KPF98-15 Industrial Democracy BillNovember 2313November 2313defeated
KPF98-14 Policing BillNovember 2313November 2313passed
KPF98-13 Reduction of Pensionable Age BillNovember 2313November 2313passed
KPF98-12 Adoption BillOctober 2313November 2313passed
KPF98-11 Regulation Reduction (Farming) BillOctober 2313November 2313passed
KPF98-10 Naturalisation BillOctober 2313November 2313passed
KPF98-9 Eminent Domain BillOctober 2313November 2313passed
KPF98-8 Regulation Reduction (Prostitution) BillOctober 2313November 2313passed
KPF98-7 Regulation Reduction (Hemp) BillOctober 2313November 2313passed
Free Public Transport ActSeptember 2313February 2314defeated
National Sport (Clarification) ActSeptember 2313September 2313passed
Intelligence agencyAugust 2313February 2314passed
Local environmentalismAugust 2313February 2314defeated

Random fact: RP laws follow the same passing rules as in-game variable laws. Laws that are not of a constitutional nature require a simple majority "Yes" vote from active parties currently holding seats. Laws that are of a constitutional nature require a 2/3 majority "Yes" vote from active parties currently holding seats. RP laws may be abolished a simple majority vote this applies to ANY RP law.

Random quote: "If a nation expects to be ignorant and free in a state of civilization, it expects what never was and never will be." - Thomas Jefferson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51