Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: February 5497
Next month in: 01:58:55
Server time: 22:01:04, June 10, 2024 CET
Currently online (3): dnobb | Irishpoliticianliam | Klexi | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Pertetuum Kazulia[?]

This page contains information about the Pertetuum Kazulia.

This party is inactive.

Details

User[?]: Grayshades

Nation[?]: Kongeriket av Kazulmark (Kazulia)

Seats[?] in Storting[?]: 0

Color[?]:

 

Description[?]:

Kazulia is ready for Eternity. She is strong and her proud peoples are determined to claim their rightful spot in the history books and all books that have yet to be written.

We, the Perpetuum Party wish to prepare this Nation for the responsabilities and tasks ahead. We envision the three pillars to reach Eternity as following:

1. Strength.
2. Stability.
3. Efficiency.

These three cornerstones will be the strong foundations on which the People of Kazulia will be able to build their Perpetual Domain of Glory.

(see also: http://particracy.wikia.com/wiki/Pertetuum_Kazulia)

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationconvinced unitaristhighperfect
Civil Rightsmoderate restrictiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaninglimitedperfect
Government Responsibilitiesmoderate big governmentexcellentperfect
Marketconvinced regulatorexcellentperfect
Militarypacifist-leaningclose to noneperfect
Moralitymoderate progressivehighperfect
Religionmoderate secularhighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
April 245615,214,01783,320,23218.26+18.2613675018.13+136
July 245910,507,25687,695,29111.98-6.288775011.60-49
October 246112,478,47187,479,45514.26+2.2810575014.00+18
April 246419,201,11289,758,31121.39+7.1316175021.47+56
February 246622,244,79192,166,89924.14+2.7418175024.13+20
August 246824,774,77493,756,06426.42+2.2919975026.53+18
February 247014,602,77892,031,31715.87-10.5611975015.87-80
August 247211,415,21895,570,62511.94-3.929075012.00-29
September 247412,671,62097,120,89713.05+1.109875013.07+8
March 247712,314,48498,510,21212.50-0.559475012.53-4
September 247915,042,374100,996,55314.89+2.3911175014.80+17
March 248219,500,84999,571,36819.58+4.6914875019.73+37
September 248423,499,32298,983,94523.74+4.1617875023.73+30
March 248724,104,936100,518,65923.98+0.2418175024.13+3
September 248923,167,56996,043,91624.12+0.1418175024.13+0
March 249219,944,42798,820,27620.18-3.9415275020.27-29
September 249420,640,73199,355,50320.77+0.5915875021.07+6
March 249727,986,467100,836,91627.75+6.9821175028.13+53

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Pertetuum Kazulia.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471

BillCreatedVoting startedVoteBill StatusResult
Cabinet Proposal of January 4428January 4428January 4428passed
Call for early elections, November 4427November 4427November 4427passed
4426November 4426November 4426passed
Cabinet Proposal of October 4426October 4426October 4426passed
Call for early elections, September 4426September 4426September 4426passed
4422 Statsoverhode billApril 4422April 4422defeated
Cabinet Proposal of December 4421December 4421December 4421passed
R.I. 4421 - Declaration of War on the Xsampa-Hanzen-Medina AxisSeptember 4421January 4428passed
OOC: Authorisation for involvement in the Dovani WarSeptember 4421January 4428passed
Statsoverhode term limitJuly 4419July 4419passed
R.I. 4419 - "Sanctions on the Kingdom of Vanuku [Phase:1]"May 4419May 4419passed
R.I. 4419 - "Sanctions on the Kingdom of Vanuku"May 4419May 4419defeated
R.I. 4419 - "Expulsion of Vanukean Diplomatic Personnel"May 4419May 4419passed
Nation Name Change Act 4419March 4419March 4419passed
Ratification of the Kazulian-Barmenistani Treaty of Friendship, Respect and Mutual DefenceFebruary 4419February 4419defeated
Cabinet Proposal of October 4418October 4418October 4418defeated
Environmental Protection Reform Act 4418February 4418February 4418passed
Cabinet Proposal of February 4418February 4418February 4418passed
Flag Change Act 4418February 4418February 4418passed
Nobility Reinstatement Act 4418February 4418February 4418passed

Random fact: The Real-Life Equivalents Index is a valuable resource for finding out the in-game equivalents of real-life cultures, languages, religions, people and places: http://forum.particracy.net/viewtopic.php?f=11&t=6731

Random quote: "Public schools are government-established, politician- and bureaucrat-controlled, fully politicized, taxpayer-supported, authoritarian socialist institutions. In fact, the public-school system is one of the purest examples of socialism existing in America." - Thomas L. Johnson

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51