Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: January 5479
Next month in: 01:51:26
Server time: 18:08:33, May 05, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Association royaliste de Lourenne[?]

This page contains information about the Association royaliste de Lourenne.

This party is inactive.

Details

User[?]: Beaumont

Nation[?]: Royaume Uni de Lourenne (Lourenne)

Seats[?] in Assembleé Royale (Royal Assembly)[?]: 0

Color[?]:

 

Description[?]:

An association of independent traditionalists who seek to restore the nation to a state of constitutional monarchy and enthrone François de Beaumont as François II, King of Lourenne.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationfederalist-leaninglimitedperfect
Civil Rightsrestrictive-leaninglimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsisolationist-leaningclose to noneperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketregulator-leaninghighperfect
Militarypacifist-leaningmoderateperfect
Moralitymoderate progressivelimitedperfect
Religionunknownclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 295549,984,073111,961,91444.64+44.64347545.33+34
August 296033,862,50834,004,32799.58+54.947575100.00+41

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Association royaliste de Lourenne.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320

BillCreatedVoting startedVoteBill StatusResult
Cabinet Proposal of July 4283July 4283July 4283passed
Media ReformMay 4283May 4283passed
Right to appeal in upper instanceMay 4283May 4283passed
Education reformMay 4283May 4283defeated
Economic reformMay 4283May 4283defeated
Treaty WithdrawlMay 4283May 4283passed
Treaty withdrawalApril 4283April 4283passed
Cabinet Proposal of April 4283April 4283April 4283defeated
Semi-presidential systemApril 4283April 4283defeated
Call for early elections, March 4283March 4283March 4283passed
Multiple Citizenship BillAugust 4280August 4280passed
Multiple Citizenship BillAugust 4280August 4280defeated
Campaign Finance ReformAugust 4280August 4280passed
National Firefighting Service BillAugust 4280August 4280passed
Eminent Domain BillAugust 4280August 4280defeated
.July 4280July 4280passed
Treaty withdrawal Proposal IIIJuly 4280July 4280defeated
Cabinet Proposal of July 4280July 4280July 4280passed
Diplomatic Immunity BanOctober 4279October 4279passed
Security Council NominationsOctober 4279October 4279passed

Random fact: Particracy has been running since 2005. Dorvik was Particracy's first nation, the Dorvik Social Democrats the first party and the International Greens the first Party Organisation.

Random quote: "I have opinions of my own - strong opinions. But I don't always agree with them." - George W. Bush

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51