Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5476
Next month in: 00:26:15
Server time: 07:33:44, April 28, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Unionen av Frihet[?]

This page contains information about the Unionen av Frihet.

This party is inactive.

Details

User[?]: Cortez III

Nation[?]: Kongeriket av Kazulmark (Kazulia)

Seats[?] in Storting[?]: 0

Color[?]:

 

Description[?]:

Unionen av Frihet- UaF

For more detailed information see: http://particracy.wikia.com/wiki/Unionen_av_Frihet

Founded in September 3460, the Unionen av Frihet (luthori: Union For Freedom) stands for a limited government and maximum freedom possible. "The long forgotten right endowed by God to all citizens is freedom from government. Government likes to forget this right."

Platform:
SOCIAL:
Abortion: Should be illegal with exception of risk of mothers health
Marriage: Should not be a government run institution
Death Penalty: Should be an option for plural homicides
Global Warming: Global warming exists however humans have little effect on this natural process.
ECONOMIC:
Minimum Wage: A minimum wage should be a method to protect people, but also shouldnt be an over the top wage.
Budget: The UaF will never vote for an unbalanced budget.
Bailouts: We only support bailouts of companies that are absolutely essential for the survival of Kazulia.
Farm Subsidies: We believe in small subsidies for low-income farmers, but not on specific products
Taxs: The UaF supports Tax Cuts for all Kazulians.
DOMESTIC POLICY
Firearms: The government should only restrict fully automated weapons and concealed carries should be allowed.
Drugs: The UaF does not seek to legalize drugs that would inflict on the mental state of a person.
Positive Discrimination: There is no positive discrimination.
HEALTHCARE
Marijuana: The government should not legalize Marijuana.
Universal Healthcare: As opposed to universal healthcare, we should lower taxes so people can afford their own healthcare.
FOREIGN:
Military: The defense budget should be maintained in order to practice peace through strength
Foreign Policy: Kazulia should only intervene in other countries affairs when it directly concerns Kazulia.
IMMIGRATION
Illegal Immigrants: Illegal immigrants should not receive welfare.
BUDGET PRIORITIES
The UaF should invest heavily in education and maintaining a moderate defense budget and lowering other areas of spending to lower taxes.

Chair: Tomas Thule (3460-)

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationfederalist-leaningexcellentperfect
Civil Rightsrestrictive-leaningexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsinternationalist-leaningexcellentperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketmoderate regulatorexcellentperfect
Militaryconvinced militaristlimitedperfect
Moralityconservative-leaningexcellentperfect
Religionmoderate secularexcellentperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
January 34645,099,77458,138,0248.77+8.77232758.36+23
May 34675,999,46454,608,81010.99+2.213027510.91+7
May 34713,499,44158,931,3165.94-5.05162755.82-14

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Unionen av Frihet.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471

BillCreatedVoting startedVoteBill StatusResult
Eminent domain, 2216September 2216September 2216passed
Cabinet Proposal of September 2216September 2216September 2216passed
Call for early elections, July 2216July 2216July 2216passed
Welfare act, 2215April 2215April 2215passed
Opened borders act 2215February 2215February 2215passed
Economic reform, 2215February 2215February 2215defeated
libertarian valuesJanuary 2215January 2215passed
Time to make a big bill!January 2214February 2214defeated
Call for early elections, January 2214January 2214January 2214defeated
Freedom of Religion, Freedom From FearDecember 2213November 2215passed
Liberty & SecurityDecember 2213November 2215defeated
Innocence ActDecember 2213November 2215passed
Decentralization & ResponsibilityDecember 2213November 2215defeated
libertarian valuesDecember 2213December 2213defeated
Citizen ProtectionDecember 2213December 2213defeated
Freedom of Religion, Freedom From FearDecember 2213December 2213passed
Republic act, 2213October 2213October 2213defeated
Cabinet Proposal of October 2213October 2213October 2213passed
ENVIRONMENTJune 2211June 2211defeated
More power to people!March 2211March 2211defeated

Random fact: If you have a question, post it on the forum. Game Moderators and other players will be happy to help you. http://forum.particracy.net/

Random quote: "The communist revolution is the most radical rupture with traditional property relations; no wonder that its development involves the most radical rupture with traditional ideas." - Karl Marx

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51