Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: August 5477
Next month in: 03:49:47
Server time: 04:10:12, May 01, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Liberal Party of Keymon[?]

This page contains information about the Liberal Party of Keymon.

This party is inactive.

Details

User[?]: IrishLily

Nation[?]: Fürstentum vu Kéimun (Keymon)

Seats[?] in Chamber of Deputéiert / Abgeordnetenkammer / Camera di i Deputati (Chamber of Deputies)[?]: 0

Color[?]:

 

Description[?]:

The Liberal Party of Keymon

"Freedom - Fairness - Progress"

Leader: James Whistler
Deputy: Charlotte Gillen

Ideology: social liberalism, progressivism
Political Position: centre-left

http://particracy.wikia.com/wiki/Liberal_Party_of_Keymon

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsmoderate permissiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistmoderateperfect
Government Responsibilitiessmall government-leaningexcellentperfect
Marketregulator-leaningexcellentperfect
Militarymoderate militaristmoderateperfect
Moralityconvinced progressivehighperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
July 37625,20211,267,7160.05+0.0502300.00+0
September 37666,428,67712,703,31950.61+50.5611723050.87+117
November 37708,885,51812,297,02472.26+21.6516623072.17+49
January 37753,937,8338,074,17748.77-23.4911223048.70-54
March 37794,380,13611,545,19237.94-10.838723037.83-25
May 37833,616,4649,923,02036.45-1.498423036.52-3
July 37874,458,14712,082,59536.90+0.458523036.96+1

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Liberal Party of Keymon.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425

BillCreatedVoting startedVoteBill StatusResult
Re-BillMay 3054June 3054passed
Love BillOctober 3053October 3053passed
Housing BillMay 3053May 3053passed
Libraries BillMay 3053May 3053passed
Logical BillMay 3053May 3053defeated
Region Name BillMay 3053May 3053defeated
Omnibus Measure IFebruary 3053February 3053passed
Flag BillNovember 3052November 3052passed
Formal NamesApril 3052April 3052passed
Keymonite Independence ActDecember 3050December 3050passed
Cabinet Proposal of December 3050December 3050December 3050passed
Call for early elections, November 3047November 3047November 3047defeated
KPU BillOctober 3045October 3045defeated
UKIP Manifesto: EcologyNovember 3043November 3043defeated
UKIP Manifesto: ReligionNovember 3043November 3043defeated
New BillSeptember 3043October 3043defeated
Smoking BillAugust 3042August 3042passed
Eminent Domain BillAugust 3042August 3042passed
Dangerous Weapons BillAugust 3042August 3042passed
Tobacco BillAugust 3042August 3042passed

Random fact: Jelbic = "Group of cultures with an overall Central Asian/Eurasian steppe theme, using a fictional language developed specifically for Particracy".

Random quote: "The spirit of democracy is not a mechanical thing to be adjusted by abolition of forms. It requires change of heart." - Mahatma Gandhi

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51