Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: April 5476
Next month in: 01:22:05
Server time: 06:37:54, April 28, 2024 CET
Currently online (0): Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Kundrati Imperialists[?]

This page contains information about the Kundrati Imperialists.

This party is inactive.

Details

User[?]: TheOneTruePi

Nation[?]: Kundrati Union (Kundrati)

Seats[?] in Legebiltzarra/Národná rada (National Legislature)[?]: 0

Color[?]:

 

Description[?]:

Party Heads:
Head of Party: Thracius Antonina
Deputy Head of Party: Lucianus Seneca
Head of Senate: Horatia Claudius
Deputy head of Senate: Crispus Caecilia
------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
The Kundrati Imperialists wish to reinstate the monarchy of Kundrati under the Imperator with elected Consul of the Senate. TKI stands for tradition, state controlled industry and the Kundrati Moral values.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsmoderate internationalistclose to noneperfect
Government Responsibilitiesbig government-leaningmoderateperfect
Marketconvinced regulatormoderateperfect
Militaryconvinced militaristlimitedperfect
Moralitymoderate progressivemoderateperfect
Religionmoderate secularmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 416341,48057,436,0360.07+0.0705410.00+0
December 416618,32161,150,1700.03-0.0405410.00+0
December 417839,04458,797,1820.07+0.0405410.00+0
December 41873,449,12859,153,6295.83+5.76355776.07+35
January 41908,959,43161,050,11514.68+8.848757715.08+52
January 41937,754,99860,887,95212.74-1.947557713.00-12
January 41968,650,33656,976,34815.18+2.459357716.12+18
January 41999,259,73453,710,66217.24+2.0611357719.58+20
January 420213,038,83752,564,76224.81+7.5714057724.26+27
January 42055,247,30659,354,8358.84-15.96505778.67-90
January 42074,699,58159,392,9367.91-0.93445777.63-6
January 421012,039,09456,404,23221.34+13.4312557721.66+81
January 421310,590,69845,009,72823.53+2.1914560024.17+20
February 429329,543,77860,144,41949.12+25.5930261549.11+157
July 517711,779,85653,003,07422.22-26.909945022.00-203

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Kundrati Imperialists.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346

BillCreatedVoting startedVoteBill StatusResult
The right to perform an abortion for a pregnant woman.August 2488October 2488defeated
Government policy on subsidising contraceptionAugust 2488October 2488passed
Government policy towards giving aid to foreign countries.February 2488June 2489passed
Train Operating Companies (TOC).February 2488October 2488passed
The government's policy concerning farm size.February 2488October 2488passed
Military/National ServiceFebruary 2488October 2488defeated
EducationJanuary 2488October 2488passed
Freedom Act, Part III: Freedom to Fire Unproductive WorkersJanuary 2488January 2488passed
EcologyJanuary 2488January 2488defeated
The research and development of pharmaceutical drugsJanuary 2488January 2488passed
The banking system.January 2488January 2488passed
Prison policy concerning prisoner labor.November 2487November 2487passed
Budget proposal of August 2487August 2487October 2495defeated
Income tax proposal of August 2487August 2487November 2487passed
Government policy on the nation's power grid.August 2487August 2487passed
Government policy on energy generation.August 2487August 2487passed
Eminent Domain.August 2487August 2487defeated
Freedom Act, Part II: Freedom to ProsperJuly 2487January 2488passed
Freedom Act, Part I: Freedom to BelieveJuly 2487January 2488passed
Pharmaceutical drugs policyJuly 2487July 2487passed

Random fact: In cases where a party has no seat, the default presumption should be that the party is able to contribute to debates in the legislature due to one of its members winning a seat at a by-election. However, players may collectively improvise arrangements of their own to provide a satisfying explanation for how parties with no seats in the legislature can speak and vote there.

Random quote: "Radical left-wing ideologies must be stamped out." - Franklin McCarthy, former Solentian politician

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51