Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: July 5475
Next month in: 00:19:45
Server time: 19:40:14, April 26, 2024 CET
Currently online (1): TaMan443 | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Sozialistische Reichspartei[?]

This page contains information about the Sozialistische Reichspartei.

This party is inactive.

Details

User[?]: wimadal

Nation[?]: Bundesrepublik Dundorf (Dundorf)

Seats[?] in Bundestag[?]: 0

Color[?]:

 

Description[?]:

Sozialistische Reichspartei Dundorf (Socialist Reich Party of Dundorf)

Leader - Jannik Klenk
Chairman - Diedrick Blauvelt

The Socialist Reich Party (SRP) Five Points:

1. The Socialist Reich Party demands the formation of a strong central government, with power concentrated in the hands of the national parliament over the whole Reich, led by one strong leader, all upholding the common interests as their mission.

2. The Socialist Reich Party demands freedom of religion for all religious denominations so long as they do not endanger the state and oppose the morality of the people. We stand against decadence where ever it is and in all it’s forms (homosexuality, feminism, substance abuse, etc) and believe that all, regardless of denomination, must stand for the good of the Reich before that of the individual.

3. The Socialist Reich Party demands that only those of Dundorfian blood are to be allowed to be citizens. Those without citizenship are only allowed to stay in Dundorf as guests, subject to legislation pertaining to the treatment of foreigners in the Reich.

We also demand that the immigration of those of foreign blood must be halted at once, but hold our arms open, ready to embrace all ethnic Dundorfians throughout the world who wish to return to the Reich.

4. The Socialist Reich Party demands that the state be charged with providing the opportunity for a livelihood and maintenance of a way of life for all citizens. We therefore demand that all workers be paid a wage that will ensure them with a high standard of living and a large-scale expansion of old-age pensions.

We believe that excessive, unfettered capitalism leads to decadence and encourages citizens to put selfish individuals needs before the good of the community. We would therefore place strict regulations and nationalize some industries for the good of the Reich.

5. The Socialist Reich Party demands that the state maintain a large, strong national military, able to defend the Reich against foreign invasion and internal subversion. Homosexuals, those not of Dundorfian blood, and women (women must take up the even more important role of being a mother) are not to be allowed to be in any branch of the military.

We also demand that Dundorf have the freedom to act as it wishes in relation to other nations.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaninghighperfect
Civil Rightsmoderate restrictiveexcellentperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced isolationistmoderateperfect
Government Responsibilitiessmall government-leaninghighperfect
Marketmoderate regulatorhighperfect
Militarymoderate militaristlimitedperfect
Moralityconvinced conservativehighperfect
Religionsecular-leaninghighperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
August 253098,240130,548,5790.08+0.0806000.00+0
August 253222,818,565122,143,99818.68+18.6111660019.33+116
August 253427,863,521123,538,08322.55+3.8713660022.67+20
August 253616,355,364129,029,44512.68-9.887560012.50-61
August 253811,490,292127,701,3529.00-3.68526008.67-23
August 254013,231,056129,783,15910.19+1.206060010.00+8
August 254220,142,324120,838,33716.67+6.479660016.00+36
September 254319,531,266125,979,36515.50-1.179160015.17-5
September 254520,817,505128,993,34816.14+0.639660016.00+5
September 254721,663,733129,040,99016.79+0.659860016.33+2
September 254918,605,462133,293,61013.96-2.838360013.83-15
September 255124,159,348132,514,59918.23+4.2710760017.83+24
October 255321,221,154128,572,16016.51-1.739860016.33-9
October 255518,844,558139,540,51013.50-3.008060013.33-18
October 255714,655,750134,978,80610.86-2.656560010.83-15
October 255925,914,454127,750,53520.29+9.4312060020.00+55
October 256125,416,572129,347,60619.65-0.6411660019.33-4
October 256327,399,048130,526,00720.99+1.3412460020.67+8
October 256519,828,431129,838,62615.27-5.728660014.33-38
October 256722,953,404126,549,01718.14+2.8710360017.17+17
October 256925,081,179127,481,43919.67+1.5411260018.67+9
September 257129,487,338148,246,74219.89+0.2211860019.67+6
January 257229,248,276147,511,57519.83-0.0611760019.50-1
July 257229,214,983148,708,57519.65-0.1811660019.33-1
December 257229,509,441148,239,01519.91+0.2612060020.00+4
June 257330,155,736148,542,07420.30+0.3912160020.17+1
July 257328,511,645147,272,53819.36-0.9411560019.17-6
January 257429,204,718147,629,51119.78+0.4211860019.67+3
February 257429,352,148149,365,07019.65-0.1311860019.67+0
June 257428,184,325147,357,15819.13-0.5211460019.00-4
June 257528,957,544129,906,44122.29+3.1612960021.50+15
September 257627,327,457126,579,14121.59-0.7012460020.67-5
December 257727,411,123126,530,99421.66+0.0712760021.17+3
July 257927,237,238129,211,10721.08-0.5812160020.17-6
July 258536,809,078148,795,21624.74+3.6614960024.83+28
July 259155,427,977149,271,08837.13+12.3922360037.17+74
October 259382,275,453159,345,98051.63+14.5031160051.83+88
October 259968,631,299168,904,80240.63-11.0024760041.17-64
October 260232,058,747129,280,13424.80-15.8414560024.17-102
October 260525,644,953151,327,06816.95-7.859860016.33-47
July 260627,481,822158,495,68717.34+0.3910260017.00+4
November 260631,100,489152,646,86020.37+3.0312160020.17+19
November 260925,511,137157,333,75916.21-4.169560015.83-26
November 261228,593,134163,980,33517.44+1.2210260017.00+7
November 261525,051,884167,737,10814.94-2.509060015.00-12
August 261628,370,307167,594,94216.93+1.9910160016.83+11
August 261928,255,642173,893,73616.25-0.689860016.33-3
August 262226,624,484178,134,90314.95-1.309160015.17-7
August 262531,327,599162,214,61019.31+4.3711660019.33+25
August 262846,216,998169,804,37327.22+7.9116560027.50+49
January 262957,027,929167,578,76234.03+6.8120460034.00+39
October 262964,015,957168,052,01838.09+4.0623060038.33+26
October 263247,187,435171,430,01027.53-10.5716660027.67-64
September 263449,010,524149,763,10232.73+5.2019860033.00+32
September 263746,754,846124,867,68037.44+4.7223360038.83+35
September 264069,238,646130,831,94852.92+15.4832460054.00+91
September 264366,540,135132,355,92450.27-2.6531060051.67-14
September 264694,989,908180,016,62052.77+2.4931960053.17+9
September 264968,795,916155,453,75344.25-8.5127260045.33-47
September 265281,322,128166,776,86148.76+4.5129360048.83+21
September 265577,687,746163,735,47547.45-1.3128960048.17-4
September 265878,505,455164,591,58947.70+0.2529060048.33+1
September 266147,958,128189,414,06925.32-22.3815560025.83-135
September 266463,557,989193,192,60732.90+7.5820060033.33+45
September 266744,402,568200,923,90522.10-10.8013460022.33-66
September 267017,632,961187,831,5229.39-12.71566009.33-78
September 267318,298,503191,288,5619.57+0.18556009.17-1
September 267618,555,999200,696,2179.25-0.32546009.00-1
June 267722,257,317201,911,96711.02+1.786460010.67+10
June 268030,339,889207,463,24814.62+3.608760014.50+23
June 268324,969,214204,701,98212.20-2.437359912.19-14
June 268629,058,801204,861,89414.18+1.998659914.36+13
November 268734,369,871201,317,79517.07+2.8910359917.20+17
November 269044,678,911188,085,56123.75+6.6814059923.37+37
November 269335,225,746190,575,04018.48-5.2710659917.70-34
November 269641,608,125204,470,25420.35+1.8711859919.70+12
February 269839,743,826173,851,08922.86+2.5113759922.87+19
February 270145,190,871211,409,58821.38-1.4812759521.34-10
February 270630,067,809206,697,94114.55-6.837750015.40-50
April 270876,911,928204,996,50437.52+22.9718750037.40+110
April 271365,335,851215,832,55430.27-7.2514850029.60-39
April 271863,929,444214,064,06129.86-0.4114750029.40-1
October 272052,370,649209,110,26425.04-4.8212550025.00-22
October 272442,092,793236,372,09517.81-7.248950017.80-36
February 272553,331,153230,205,97223.17+5.3611950023.80+30
February 272858,502,817230,710,12825.36+2.1912850025.60+9
February 273167,836,709222,342,64130.51+5.1515350030.60+25
February 273439,138,514222,157,32117.62-12.898950017.80-64
February 273749,550,661227,444,29121.79+4.1710850021.60+19
February 2740112,311,712241,199,78146.56+24.7822550045.00+117
February 274399,111,530223,719,93044.30-2.2621250042.40-13

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Sozialistische Reichspartei.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749

BillCreatedVoting startedVoteBill StatusResult
Cabinet Proposal of January 3998January 3998January 3998passed
Repeal of the Neue GrundlageNovember 3997November 3997passed
Animal Protection ActAugust 3997November 3997passed
International Relations ActFebruary 3997February 3997defeated
Ban on Private HuntingMay 3996May 3996defeated
Treaty WithdrawalApril 3996April 3996passed
Growth ActJanuary 3996January 3996defeated
Eminent Domain ActOctober 3995May 3996defeated
Freedom of Information ActOctober 3995May 3996defeated
Wild Animals ActAugust 3995July 3996defeated
Smoking ActAugust 3995January 3996defeated
Gambling ActAugust 3995January 3996defeated
Military Reform ActNovember 3994February 3995defeated
Stem Cell and GM ActFebruary 3994August 3994defeated
Tax on donations to religious institutions.February 3994August 3994passed
Workers Rights ActDecember 3993August 3994defeated
WMD ActDecember 3993August 3994defeated
Anti Landmine ActDecember 3993August 3994defeated
Organ Donation ActDecember 3993August 3994defeated
Deregulation ActDecember 3993July 3994defeated

Random fact: Any RP law granting extraordinary "emergency powers" or dictator-like powers to a government must be passed by at least a 2/3rds majority, but (like all RP laws) may always be overturned by a simple majority vote of the legislature.

Random quote: "Today's political campaigns function as collection agencies for broadcasters. You simply transfer money from contributors to television stations." - Bill Bradley

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 55