Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: September 5573
Next month in: 02:08:40
Server time: 17:51:19, November 24, 2024 CET
Currently online (1): ImportantGuy | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Hobrazian Extraordinary Gentlemen's Club[?]

This page contains information about the Hobrazian Extraordinary Gentlemen's Club.

This party is inactive.

Details

User[?]: Moondee

Nation[?]: Hobratsuri Respublika (Hobrazia)

Seats[?] in Erovnuli Asamblea (National Assembly) [?]: 0

Color[?]:

 

Description[?]:

November 2704 - ... . Sintija Almerto III


Since the participation in the first elections for the party, which happened June 2628, the political union has been growing steadily.


The major \"successes\" occurred June 2643 and June 2652, when the one by one two competing political parties left the political arena in Hobrazia, which has led to an expansion of Hobrazian Extraordinary Gentlemen\'s Club- formerly Hobrazian Social Justice Party. In the year 2652 HEGC\'s candidate for the state office - Seline Sanyen- lost with just a minor difference in the second round of the vote.

At the moment the party\'s goal is to acquire an independent and honest victory at the imperial chamber elections and state office, which would not be connected to the leave of the other political groupings the moments before the day of elections.

Oh, we are a fun league, enjoying funny things.




(((old :A newly formed party consists of members from different counties of Second Imperial Republic of Hobrazia. Party\'s leadership openly favors and supports socialistic ideology.

The party announced society\'s well-being as it main objective and makes attempts at changing the situation and atmosphere in the country for the better. The party is a strong supporter of reforms being made the peaceful way.

Moondee Ayola, the leader of the Hobrazian Social Justice Party, in his first press-conference announced his party being both interested and always open for the constructive dialogues with candidates of the other parties in legislative process in order to achieve the better good for the country.

Further he repeated that once and if his party manages to win the trust of the citizens and will acquire seats in the Imperial Chamber, party will look forward to active cooperation and participation in negotiations with other parties regarding any proposals and initiatives they might have.


So far in the Cabinet:
Ministry of Foreign Affairs Seely Jetkins
Ministry of Justice Olyar Napkee
Ministry of Infrastructure and Transport Alex Fredisson
Ministry of Health and Social Services Zeta Strong
Ministry of Education and Culture Lionel Wilson ))Seline Sanyen

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate unitaristmoderateperfect
Civil Rightsrestrictive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsinternationalist-leaningclose to noneperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketregulator-leaningmoderateperfect
Militaryunknownclose to noneperfect
Moralitymoderate conservativelimitedperfect
Religionsecular-leaninglimitedperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
June 262862,620134,665,8800.05+0.0504000.00+0
June 263122,668,546145,308,80915.60+15.556240015.50+62
July 263218,510,929131,137,37414.12-1.485540013.75-7
July 263515,914,943135,658,25511.73-2.384640011.50-9
July 263810,671,500133,837,8337.97-3.76314007.75-15
July 26418,370,452136,905,7856.11-1.86244006.00-7
June 264321,305,818138,557,68415.38+9.266140015.25+37
June 264622,701,941140,213,68716.19+0.816240015.50+1
June 264921,278,509144,618,31514.71-1.485940014.75-3
June 265236,720,285141,955,10125.87+11.1510340025.75+44
June 265515,663,158146,173,90310.72-15.154240010.50-61
November 265630,422,311132,781,59322.91+12.208940022.25+47
November 265931,314,014131,607,71123.79+0.889340023.25+4
November 266241,453,623129,932,67531.90+8.1112540031.25+32
November 266544,839,116139,415,31232.16+0.2612940032.25+4
November 266839,364,904142,500,14227.62-4.5411040027.50-19
November 267131,558,175143,336,28622.02-5.618940022.25-21
November 267434,498,824155,097,10022.24+0.238840022.00-1
November 267720,674,672161,417,60712.81-9.444940012.25-39
November 268034,332,914158,421,35621.67+8.868740021.75+38
November 268320,198,821156,427,53412.91-8.765340013.25-34
November 268619,069,699152,700,15312.49-0.425140012.75-2
November 268920,273,894154,687,96513.11+0.625340013.25+2
November 269218,386,604157,634,41311.66-1.444540011.25-8
November 269528,967,070163,254,46517.74+6.087140017.75+26
November 269829,223,248161,470,55018.10+0.357340018.25+2
November 270128,946,983164,382,40317.61-0.497040017.50-3
November 270440,051,692164,900,11624.29+6.689840024.50+28
November 270718,980,759167,779,85311.31-12.984540011.25-53
November 271016,241,060170,313,1149.54-1.78364009.00-9
November 271310,820,005173,894,6606.22-3.31234005.75-13
November 271612,284,146175,255,0547.01+0.79284007.00+5
November 271911,289,292174,692,4146.46-0.55254006.25-3

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Hobrazian Extraordinary Gentlemen's Club.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349

BillCreatedVoting startedVoteBill StatusResult
Foreign Policy Reform ActAugust 3802August 3802passed
Eminent Domain BillAugust 3802August 3802passed
Environment BillJuly 3802July 3802defeated
Morality BillJuly 3802July 3802defeated
Reduction of Corporate TaxJuly 3802July 3802defeated
Military Revitalization ActJuly 3802July 3802passed
Schools of Choice ActJuly 3802July 3802passed
Welfare AdjustmentFebruary 3802March 3802defeated
Agricultural Reform Act of 3802February 3802March 3802passed
Equal Protection Act of 3802February 3802February 3802passed
Cabinet Proposal of December 3801December 3801December 3801passed
Education Omnibus BillAugust 3801February 3802defeated
Freedom of Religion Act of 3801August 3801October 3801passed
Ratification of the International Convention on Workers RightsAugust 3801October 3801defeated
Monopoly Policy ReformAugust 3801October 3801defeated
Ratification of the Anti-Monarchist TreatyAugust 3801October 3801passed
Forest Mangement ActApril 3801October 3801defeated
Education Reform ActApril 3801October 3801defeated
Stem Cell Code ReformationApril 3801October 3801defeated
People's Network ActApril 3801October 3801defeated

Random fact: Use a valid e-mail address for your Particracy account. If the e-mail address you entered does not exist, your account may be suspected of multi-accounting and inactivated.

Random quote: "Wherever you have an efficient government, you have a dictatorship." - Harry S. Truman

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51