Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: February 5497
Next month in: 02:37:57
Server time: 21:22:02, June 10, 2024 CET
Currently online (2): botangabrielkizenia | Irishpoliticianliam | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


Growth and Prosperity Party[?]

This page contains information about the Growth and Prosperity Party.

This party is inactive.

Details

User[?]: danyeo

Nation[?]: Jelbék H'ánknstat (Jelbe)

Seats[?] in Bltmojad Knzsrlji Vezr (Council of Royal Advisors)[?]: 0

Color[?]:

 

Description[?]:

The Growth and Prosperity Party Promises the "Three Truths"
1) Promote growth through economic freedom
2) Uphold the sanctity of individual rights and responsibilities
3) Stop the Bear Agenda

For more information about the GPP, visit our wiki:
http://80.237.164.51/particracy/wiki/index.php/Growth_Prosperity_Party

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationmoderate federalistmoderateperfect
Civil Rightspermissive-leaningmoderateperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsconvinced internationalistlimitedperfect
Government Responsibilitiesmoderate small governmentexcellentperfect
Marketmoderate laissez-fairehighperfect
Militarymoderate militaristlimitedperfect
Moralitymoderate progressivelimitedperfect
Religionsecular-leaningmoderateperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
December 222331,38050,109,1610.06+0.0606250.00+0
June 222811,860,65545,484,20326.08+26.0116062525.60+160
December 223216,771,52546,351,47836.18+10.1122662536.16+66
July 223624,101,17442,295,75056.98+20.8035262556.32+126
May 224027,460,13950,106,96054.80-2.1834162554.56-11

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the Growth and Prosperity Party.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338

BillCreatedVoting startedVoteBill StatusResult
Ratification of the Anti-Zardic Imperialism Majatran Front (AZIMF)November 3579November 3579passed
IndependenceNovember 3579November 3579passed
Establishment of the Great Jelbék HordeNovember 3579November 3579passed
Jelbek Freedom ActFebruary 3578April 3578passed
Cabinet Proposal of February 3578February 3578February 3578passed
Focus on the Family Act of 3576November 3576November 3576passed
Eminent Domain Act of 3576November 3576November 3576passed
Rowens Act of 3576November 3576November 3576passed
National Radio and Television Act of 3576November 3576November 3576passed
The Reinstitution of the Imperial Central BankNovember 3576November 3576passed
National Defense Reform Initiative of 3576November 3576November 3576passed
Education Reform Act of 3576November 3576November 3576passed
Anti-Imperialist ActNovember 3576November 3576defeated
OOC: Jelbek Names (DO NOT DELETE)November 3576 debate
Progressive Morality ActOctober 3576November 3576defeated
Nationalist Movement Party ManifestoNovember 3575November 3575defeated
More rights to regionsOctober 3575October 3575defeated
Immigration Act of 3573March 3573March 3573passed
Ratification of the The International Monarchist LeagueDecember 3572December 3572passed
Cabinet Proposal of September 3572September 3572September 3572passed

Random fact: The grey space in the east is populated by the forum-based countries, known in-game as the former colonies or the "Third World". These countries are managed by the Third World Coordinator but players can request control of individual countries in the Third World Control Requests thread: http://forum.particracy.net/viewtopic.php?f=11&t=8302

Random quote: "Ask the experimenters why they experiment on animals, and the answer is: "Because the animals are like us." Ask the experimenters why it is morally okay to experiment on animals, and the answer is: "Because the animals are not like us." Animal experimentation rests on a logical contradiction." - Charles R. Magel

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 51