Main | About | Tutorial | FAQ | Links | Wiki | Forum | World News | World Map | World Ranking | Nations | Electoral Calendar | Party Organizations | Treaties |
Login | Register |
Game Time: October 5487
Next month in: 03:00:21
Server time: 04:59:38, May 23, 2024 CET
Currently online (1): Moxi | Record: 63 on 23:13:00, July 26, 2019 CET

We are working on a brand new version of the game! If you want to stay informed, read our blog and register for our mailing list.

| Details | Ministries | Political Positions | Affiliations | Election Results | Legislation | Legislative Agenda | Voting Record | Actions | Messages |


die Volkspartye[?]

This page contains information about the die Volkspartye.

This party is inactive.

Details

User[?]: konservativ

Nation[?]: Federale Republiek van Seridjan (Saridan)

Seats[?] in Volksraad (People's Council)[?]: 0

Color[?]:

 

Description[?]:

die Volkspartye is a political union established by businessman Jan van Janssens.

"For too long has Saridan been dominated by socialists! It is time for God and family to yet again become the linchpins of society, while keeping freedom." - Jan van Janssens

The Volkspartye is a center-right political party in Saridan. It was formed as a conservative reaction to the Socialist Party.

Ministries

This party is not part of the national cabinet.

Political Positions

IdeologyPositionVisibilityCoherency
Centralizationunitarist-leaningclose to noneperfect
Civil Rightsrestrictive-leaninglimitedperfect
Ecologyskeptic-leaninglimitedperfect
Foreign Relationsunknownclose to noneperfect
Government Responsibilitiessmall government-leaningmoderateperfect
Marketmoderate laissez-fairemoderateperfect
Militaryunknownclose to noneperfect
Moralitymoderate conservativeclose to noneperfect
Religionunknownclose to noneperfect

Affiliations

This party is a member of the following organizations:

Election Results

History Table

MonthVotesTotal VotesVotes (%)Votes (%) (+)SeatsTotal SeatsSeats (%)Seats (+)
February 362736,77456,485,0930.07+0.0707500.00+0
March 362842,14956,671,5450.07+0.0107500.00+0
August 362845,21257,163,3140.08+0.0007500.00+0

Relative Graph

This graph shows the percentage of seats the party achieved in each election, relative to its maximum.

Election History

Absolute Graph

This graph shows the percentage of seats the party achieved in each election in the entire legislature.

Election History

National Graph

This graph shows the share of seats the party achieved in each election in the entire legislature, together with the share of other parties.

Election History

Legislation

You can view the party's proposed bills here.

Legislative Agenda

This party has to vote on the following bills:

Voting Record

This is the voting[?] record of the die Volkspartye.

Page 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392

BillCreatedVoting startedVoteBill StatusResult
Budget proposal of November 3363November 3363November 3363passed
Eminent Domain ReformJanuary 3362January 3362passed
ReformsNovember 3361May 3362passed
Revision Act No.1November 3361November 3361passed
Red ProposalNovember 3361November 3361defeated
Ratification of the Openning An Embassy in Jakania PolicyMay 3361May 3361defeated
Morality Intiatives Pt.1May 3361May 3361defeated
Cabinet Proposal of July 3360July 3360November 3361passed
Defense, Economical, & Foreign Affairs ActJuly 3360July 3360passed
Civil rights actMay 3360June 3360defeated
Reform Bill of 3360February 3360February 3360passed
Land Reform Act of 3359February 3359February 3359passed
Revised Reforms & ProposalsNovember 3358November 3358passed
Ratification of the Mordusian Neutrality PactNovember 3358November 3358passed
Land Reform Act of 3356February 3356February 3356defeated
Cabinet Proposal of April 3355April 3355November 3358defeated
The Ecological Clean Start ActApril 3355May 3355passed
The Health Reform Act Part !.April 3355May 3355passed
Ratification of the Openning An Embassy in Jakania PolicyApril 3355May 3355defeated
Ratification of the Protection of Marriage ActNovember 3353November 3353passed

Random fact: "Jezvraljogadsrlji" means "Social" in the Jelbic languages.

Random quote: "The theory of Communism may be summed up in the single sentence: abolition of private property." - Karl Marx

This page was generated with PHP
Copyright 2004-2010 Wouter Lievens
Queries performed: 52